DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCT3 and Hsp60B

DIOPT Version :9

Sequence 1:NP_001189236.1 Gene:CCT3 / 42029 FlyBaseID:FBgn0015019 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_524925.1 Gene:Hsp60B / 48572 FlyBaseID:FBgn0011244 Length:648 Species:Drosophila melanogaster


Alignment Length:599 Identity:132/599 - (22%)
Similarity:238/599 - (39%) Gaps:141/599 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SQNTKRESGRKVQLENIQAGKAIADVIRTCLGPQAMLKMLMDPMGGIVMTNDGNAILREITV--Q 74
            |::.:..||.:..:  |:....:||.:...:||:....::..|.....:|.||..:.|.|.:  |
  Fly    21 SKDVRFGSGVRAMM--IRGVDILADAVAVTMGPKGRSVIVERPWTSPKITKDGFTVARSIALKDQ 83

  Fly    75 HP--AAKSMIEIARTQDEEVGDGTTSVIVLAGEMLAAAEPFLQ--QQIHPTVIIRAYREALEDIV 135
            |.  .||.:.::|...:|..|||||:..|||..:  |.|.|.|  ...:|..|.|....|: |:|
  Fly    84 HMNLGAKLVQDVADNTNESAGDGTTTATVLARAI--AKEGFNQITMGANPVEIRRGVMLAV-DVV 145

  Fly   136 GHLQSQLSIQLDVKDKAKMADVVKACVGTKFIGKWSDLAVKIALDAV---ETVTLSENGRLE--- 194
            .....::|..::.:::.:....:.|...|: ||:    .:..|.|.|   .|:|:.:..||:   
  Fly   146 KDKLKEMSKAVETREEIQQVATLSANGDTE-IGR----LIGEATDKVGPRGTITVKDGKRLKDEL 205

  Fly   195 -----------------VDIKRYAKVE-----------KIPGGAIEESCVLKG-----------V 220
                             |:..:.:|||           ||.|    .|.::||           :
  Fly   206 NIIQGLRFDNGYVSPFFVNSSKGSKVEFANALVMISLKKITG----LSQIVKGLEQSLRQRRPLI 266

  Fly   221 MINKDVTHPKMRRLIENP-RIVLLDCSLE------YKK---GE--SQTNVEIIGEQ-DFTRMLQI 272
            :|.:|::...:..|:.|. |:.|..|:::      ::|   |:  :.|...|.|:. ::::|.:.
  Fly   267 IIAEDISGEALNALVLNKLRLGLQVCAVKSPSYGHHRKELIGDISAATGATIFGDDINYSKMEEA 331

  Fly   273 EEEFVQRICADIIAVKPDLVFTEKGVSDLAQHYLLKAGITAIRRLRKTDNLRIARACGATIVNRT 337
            :.|.:.::...:|:....::...|.          |.|:..:|                 |....
  Fly   332 KLEDLGQVGEAVISKDSTMLLQGKP----------KTGLLEMR-----------------IQQIQ 369

  Fly   338 EELTEKDVGTGAGLFEVKKIGDEYFTFVTECKEPKACTIL-LRGASKDILNETERNLQDALHVAR 401
            :||.||.:..     |.:....:..:.:|     |...:| :.|.|:..:||.:..:.|||:..|
  Fly   370 DELAEKQIKP-----EQRDRLRQRLSALT-----KGVAVLHIGGGSEVEVNEKKDRVVDALNATR 424

  Fly   402 NLVLEPRLVAGGGAVEMAASQLLTRKQV------KGPYTAVAHALEIIPRTLAQNCGANTIRALT 460
             ..:|..:|.|||...:.....|...:.      || ...|.:||.:..:|:|||.|.:....: 
  Fly   425 -AAIEEGIVPGGGTAFLRCIPYLQELKTESADLQKG-VDIVCNALRMPCQTIAQNAGVDGPMVV- 486

  Fly   461 ALRAKHASHTGDGVCAWGIDGESGEIVDMNVKNIWEPLAVKLQTYKTAVETAILL---------L 516
               ||..:.:.|    :|.|....|...:..|.|.:|..|.......|...|.||         .
  Fly   487 ---AKVLNGSED----YGYDAMGDEYCRLVEKGIIDPTKVLRTAITDAAGVASLLSTTEVVITDS 544

  Fly   517 RIDDIVSGSKKRGG 530
            |.||::|.....||
  Fly   545 RNDDLLSKLSGAGG 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCT3NP_001189236.1 chap_CCT_gamma 7..528 CDD:274085 130/595 (22%)
TCP1_gamma 7..524 CDD:239453 129/591 (22%)
Hsp60BNP_524925.1 PTZ00114 9..558 CDD:185455 130/597 (22%)
GroEL 22..543 CDD:239460 125/581 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453468
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0459
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.