DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCT3 and fab1

DIOPT Version :9

Sequence 1:NP_001189236.1 Gene:CCT3 / 42029 FlyBaseID:FBgn0015019 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_611269.1 Gene:fab1 / 37033 FlyBaseID:FBgn0028741 Length:1809 Species:Drosophila melanogaster


Alignment Length:334 Identity:80/334 - (23%)
Similarity:143/334 - (42%) Gaps:38/334 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 VDIKRYAKVEKIPGGAIEESCVLKGVMINKDVTHPKMRRLIENPRIVLLDCSLEYKKGESQ-TNV 258
            :||:.|...:|:|||..::|.::.||..:|:|.|..|...:..|||:||.|.:.|::.|.: ..:
  Fly   505 MDIRNYVNFKKVPGGRRKDSKIVHGVAFSKNVAHKDMATHVPFPRILLLQCPIVYERIEGKFVTI 569

  Fly   259 EIIGEQDFTRMLQIEEEFVQRICADIIAVKPDLVFTEKGVSDLAQHYLLKAGITAIRRLRKTDNL 323
            |       |.:|| |:|:::.:||.|::.||::|...|.|:.:||..|....:|.:..::.:...
  Fly   570 E-------TVLLQ-EKEYLRNVCARIMSFKPNVVLVHKNVAGIAQDLLRSYEVTLVLDVKLSVME 626

  Fly   324 RIARACGATIVNRTE-ELTEKDVGTGAGLFEVKKIGDEYFTFVTECKEPKACTILLRGASKDILN 387
            |::|.....||:..| .:|...:|. ...|.::....:...|..:...|:..|.||||.|...|.
  Fly   627 RLSRTLQCDIVSSIESNITMPKLGY-CNDFYIRNYNGKTLMFFEKLTNPRGYTCLLRGGSNAELT 690

  Fly   388 ETERNLQDALHVARNLVLEPRLVAGGGAVEMAASQLLTRKQVKGPYTAVAHALEIIPRTLAQNCG 452
            ..:|.....|....|..||...:....|..::....:...:...|.|.....|......:.:...
  Fly   691 RVKRVASALLFARYNWRLEMSFLLNEFAQPLSPKPSIFDSKETSPKTETEAELRSKRPIILERKS 755

  Fly   453 ANTIRALTA---------LRAKHASHTGDGVCAWGIDGESGEIVDMNVKNIWEPLAVKLQ---TY 505
            .:.|..:.:         |||..|.......||               ..:.|.|||:.:   .:
  Fly   756 EDKITTIVSENVSDFTDPLRASQAEALSTSPCA---------------PPVVEALAVEPRYDNRF 805

  Fly   506 KTAVETAIL 514
            :||:.:.:|
  Fly   806 RTALSSTLL 814

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCT3NP_001189236.1 chap_CCT_gamma 7..528 CDD:274085 80/334 (24%)
TCP1_gamma 7..524 CDD:239453 80/334 (24%)
fab1NP_611269.1 FYVE_PIKfyve_Fab1 182..243 CDD:277264
DEP 329..397 CDD:214489
Fab1_TCP 464..717 CDD:239450 62/220 (28%)
PIPKc 1413..1797 CDD:295374
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453476
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.