DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10324 and SPP2

DIOPT Version :9

Sequence 1:NP_650571.2 Gene:CG10324 / 42028 FlyBaseID:FBgn0038454 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_014791.1 Gene:SPP2 / 854319 SGDID:S000005674 Length:185 Species:Saccharomyces cerevisiae


Alignment Length:153 Identity:44/153 - (28%)
Similarity:73/153 - (47%) Gaps:32/153 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 TESLEQRAARELISAIQNNGAEGLDDQ-----KLVLP-ALSAD----ELPLDGAKEATLDDYDNI 159
            |.||..:...::  .||:.....||::     |||:. :.:||    :.||  .:..|..:|:.:
Yeast    40 TASLSHKPQSKI--KIQSIDKFDLDEESSSKKKLVIKLSENADTKKNDAPL--VEYVTEKEYNEV 100

  Fly   160 PIQQFGLAMLRGMGW-VDPPPKKKG------SGPIDDAPFLRPKGMGLGA--DKALKPKALLVQP 215
            |:::||.|:|||||| .|.....||      :..:.:...:.|.|:|:||  :||:..:.....|
Yeast   101 PVEEFGDALLRGMGWESDSEQDSKGDKTQSRNKDVSNVSQIHPDGLGIGAKLNKAINVEEASFMP 165

  Fly   216 EKNEVLEIKKQAYVRILGGKQKD 238
                |::|.|     |.|.|..|
Yeast   166 ----VVKIDK-----ITGTKVDD 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10324NP_650571.2 DUF2207 <67..>137 CDD:303056 10/37 (27%)
G-patch_2 146..208 CDD:289427 22/70 (31%)
KOW_GPKOW_A 227..282 CDD:240516 4/12 (33%)
SPP2NP_014791.1 G-patch_2 93..151 CDD:372242 19/57 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345214
Domainoid 1 1.000 40 1.000 Domainoid score I3261
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004009
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6078
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.