DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10324 and MOS2

DIOPT Version :9

Sequence 1:NP_650571.2 Gene:CG10324 / 42028 FlyBaseID:FBgn0038454 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_174617.1 Gene:MOS2 / 840246 AraportID:AT1G33520 Length:462 Species:Arabidopsis thaliana


Alignment Length:298 Identity:71/298 - (23%)
Similarity:126/298 - (42%) Gaps:71/298 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 EPDPEEVTPVAQSIAEVTAGGPTESLEQRAARELISAIQNNGAEGLDDQK------LVLPALSAD 141
            |.:||...|..:....::.|   .:|.|:...:.|      |.:.::::|      |:|.:|..|
plant    83 EFEPEVPLPGTEKPDNISYG---LNLRQKVKDDSI------GGDAVEERKVSMGEQLMLQSLRRD 138

  Fly   142 ELPLDGAKEATLDDYDNIPIQQFGLAMLRGMGWVDPPPKKKGSGPIDDAPFLRPK------GMGL 200
            .:.|  |.:.||:|::::|:..||.|::.|.||  .|.|..|....:|......|      |:|.
plant   139 LMSL--ADDPTLEDFESVPVDGFGAALMAGYGW--KPGKGIGKNAKEDVEIKEYKKWTAKEGLGF 199

  Fly   201 GADKALKPKALLVQPEKNEVLEIKKQAY-------------VRILGGKQKDQYGQIQGFDDHAGR 252
            ..|::   |.:.|:.:..|.:::.|:..             |||:.|:.....|:|.   :..|.
plant   200 DPDRS---KVVDVKAKVKESVKLDKKGVGINGGDVFFVGKEVRIIAGRDVGLKGKIV---EKPGS 258

  Fly   253 VIVKMAIGGAKEAFNEFLCQPVSRKEYSQYG-----KCINTAKYEEFKKNENEHGQIIVKQENPS 312
            ....:.|.|::|...      |...|.:..|     ||:.  |.::.:.|:.|      |.:..|
plant   259 DFFVIKISGSEEEVK------VGVNEVADLGSKEEEKCLK--KLKDLQLNDRE------KDKKTS 309

  Fly   313 GR---RDRDRREEIRS----DRDEAQNQKSSKPGDQRS 343
            ||   .:|..|.|:|:    ||.:.:.:| .||...||
plant   310 GRGRGAERGSRSEVRASEKQDRGQTRERK-VKPSWLRS 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10324NP_650571.2 DUF2207 <67..>137 CDD:303056 12/59 (20%)
G-patch_2 146..208 CDD:289427 19/67 (28%)
KOW_GPKOW_A 227..282 CDD:240516 12/67 (18%)
MOS2NP_174617.1 G-patch_2 143..202 CDD:372242 18/60 (30%)
KOW_GPKOW_B 405..455 CDD:240517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4315
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1427830at2759
OrthoFinder 1 1.000 - - FOG0004009
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104635
Panther 1 1.100 - - LDO PTHR15818
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3870
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.870

Return to query results.
Submit another query.