DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6IP1 and RETREG2

DIOPT Version :9

Sequence 1:NP_001262647.1 Gene:Arl6IP1 / 42027 FlyBaseID:FBgn0038453 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_077269.3 Gene:RETREG2 / 79137 HGNCID:28450 Length:543 Species:Homo sapiens


Alignment Length:185 Identity:31/185 - (16%)
Similarity:71/185 - (38%) Gaps:22/185 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LEPFRTAIVGAYGVLTWEKQYYAGVVFGVISCLYLVLWYLDLSLITLLSLLGVISILLNYAFPMV 83
            |..:...:..|..:|.|||..::.|....::.|:   |.|..|.:....||.| |:|..:...:.
Human    60 LRGWEAVLAAAQRLLVWEKPLHSLVTAAALNGLF---WLLSSSSLRPFFLLSV-SLLAYFLLDLW 120

  Fly    84 SRLIFGGVNWDGDQEAKFE----------------DVCGQVCAVKGSLVVWYEYL--FNERKSTV 130
            .......|:....:|...:                ::|..:.....:..:..:.|  :..:....
Human   121 QPRFLPDVSASSPEEPHSDSEGAGSGARPHLLSVPELCRYLAESWLTFQIHLQELLQYKRQNPAQ 185

  Fly   131 FVIVMSLGLLAMAWIGAIINNLLLMYLATLLILMWPGLQNKDIFKAITQRASKII 185
            |.:.:..|...:|.:|..:..:::.|:..|.||:||.:...::.:.:..|...::
Human   186 FCVRVCSGCAVLAVLGHYVPGIMISYIVLLSILLWPLVVYHELIQRMYTRLEPLL 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6IP1NP_001262647.1 Reticulon 29..187 CDD:251305 30/175 (17%)
RETREG2NP_077269.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..287
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 336..394
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 411..486
LIR motif. /evidence=ECO:0000305|PubMed:26040720 490..495
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 504..543
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20952
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.