DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6IP1 and retreg2

DIOPT Version :9

Sequence 1:NP_001262647.1 Gene:Arl6IP1 / 42027 FlyBaseID:FBgn0038453 Length:197 Species:Drosophila melanogaster
Sequence 2:XP_005160348.1 Gene:retreg2 / 564232 ZFINID:ZDB-GENE-061215-128 Length:546 Species:Danio rerio


Alignment Length:231 Identity:45/231 - (19%)
Similarity:92/231 - (39%) Gaps:49/231 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AASQVDQKRALNKLKHDLEPFRTAIVGAYGVLTWEKQYYAGVVFGVISCLYL--VLWYLDLSLIT 64
            |..:.:.:|...:|:..|.....|:|....:|.||:..::     :|:.|.|  :.|.|..:.:.
Zfish    25 AEEEPELRRLRERLRGCLSQCEPAVVLLQRLLVWERPLHS-----IIAALALNTLFWLLSSTSLR 84

  Fly    65 LLSLLGVISILLNY------AFPMVSRLIFGGVNWDG-----DQEAKFEDVCGQVCAVKG----- 113
            .|.||.|..|.|..      ..|.::.       |..     ::||..:.:  ::.:|:.     
Zfish    85 PLFLLSVFLIGLTLLERWKDKLPQITA-------WRPEASVIEREALSDQL--RLLSVEELSHHL 140

  Fly   114 -------SLVVWYEYLFNERKSTVFVIVMSLGLLAMAWIGAIINNLLLMYLATLLILMWPGLQNK 171
                   ||.:.....:..:....|.|:|..|...||.:|..|..:::.|:..|.:|:||.:...
Zfish   141 AESYLTFSLYIQEMLQYKRQNHGKFCIMMCSGCFTMAVVGHYIPGVMITYIILLSVLLWPLVVYH 205

  Fly   172 DIFKAITQRASKII----------NEKIQCGKRKLQ 197
            ::.:.:..|...|:          .::.:..|||::
Zfish   206 ELIQKMYTRLEPILMKLDYSMKGDTQRRKYDKRKMK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6IP1NP_001262647.1 Reticulon 29..187 CDD:251305 36/192 (19%)
retreg2XP_005160348.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20952
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.