DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6IP1 and Arl6ip1

DIOPT Version :9

Sequence 1:NP_001262647.1 Gene:Arl6IP1 / 42027 FlyBaseID:FBgn0038453 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_942032.1 Gene:Arl6ip1 / 293551 RGDID:735205 Length:203 Species:Rattus norvegicus


Alignment Length:183 Identity:54/183 - (29%)
Similarity:102/183 - (55%) Gaps:2/183 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LKHDLEPFRTAIVGAYGVLTWEKQYYAGVVFGVISCLYLVLWYLDLSLITLLSLLGVISILLNYA 79
            |:..|:.:...::.|..||.||:.::...:.||:|.|:|:::|||.|:::.:|...:...|.:|.
  Rat    19 LEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLLFLIIYYLDPSVLSGVSCFVMFLCLADYL 83

  Fly    80 FPMVSRLIFGGVNWDGDQEAKFEDVCGQVCAVKGSLVVWYEYLF--NERKSTVFVIVMSLGLLAM 142
            .|:::..|||...|..:|:.:|.::|..:...:...|.|::.||  .|.|..::.:.|.:.|.|:
  Rat    84 VPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIISLAAV 148

  Fly   143 AWIGAIINNLLLMYLATLLILMWPGLQNKDIFKAITQRASKIINEKIQCGKRK 195
            ||:|..::||||.||....:|:.|||....|.......|.:.||:.::..::|
  Rat   149 AWVGQQVHNLLLTYLIVTFVLLLPGLNQHGIILKYIGMAKREINKLLKQKEKK 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6IP1NP_001262647.1 Reticulon 29..187 CDD:251305 50/159 (31%)
Arl6ip1NP_942032.1 Arl6IP1_RETR3-like 34..200 CDD:425403 50/165 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338273
Domainoid 1 1.000 107 1.000 Domainoid score I6372
eggNOG 1 0.900 - - E1_2CN40
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41008
Inparanoid 1 1.050 108 1.000 Inparanoid score I4824
OMA 1 1.010 - - QHG45227
OrthoDB 1 1.010 - - D1268983at2759
OrthoFinder 1 1.000 - - FOG0009822
OrthoInspector 1 1.000 - - oto97657
orthoMCL 1 0.900 - - OOG6_108648
Panther 1 1.100 - - LDO PTHR20952
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.