DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nonA-l and NRD1

DIOPT Version :9

Sequence 1:NP_001262646.1 Gene:nonA-l / 42026 FlyBaseID:FBgn0015520 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_014148.1 Gene:NRD1 / 855470 SGDID:S000005195 Length:575 Species:Saccharomyces cerevisiae


Alignment Length:348 Identity:60/348 - (17%)
Similarity:103/348 - (29%) Gaps:136/348 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QQRGNSTNKNLGKPTPPKLNAA-----SDGNPAEKKARLGGNTQNGGGVAGGGGTGGGGGGGGAT 78
            :||......||.|..|..||.:     :..:||:::|.|                          
Yeast   171 KQRSKQILSNLKKSPPLNLNISLPTDLTSTDPAKQQAAL-------------------------- 209

  Fly    79 GGVEFSRNRNRGGNQNENRQGFQV--ANNSHQKQINESPKPAAGNVPAKNNELSAGGGGQNQPNH 141
                                 |||  |...|.|.:                           |:|
Yeast   210 ---------------------FQVIAALQKHFKTL---------------------------PSH 226

  Fly   142 SNKG------------QGNQGDQGEQGNQGPNFRGRGGGPNQPNQNANQEQSNGYPGNQGDNKGG 194
            ::.|            .|::.::..:..:..:.|.|...|..|....:..:.:.||....|..  
Yeast   227 TSVGTVAPPQAHTITEYGSRRERERERERYNSRRNRSRSPPAPFSQPSTGRKDRYPSVAQDQY-- 289

  Fly   195 QGQRGAGGGKHQRGNRSRRSGGSGIMNSSMGGGGQRGEDFFIAQRLLDISGPTHELP-PIE---- 254
                                 ..|..|::.|.....     :....|::|...|..| |:.    
Yeast   290 ---------------------SIGAPNTTFGTNNHH-----LYPDELNVSNNPHYRPKPVSYDST 328

  Fly   255 LPTDNKFVGRNRLYVGNLTSDTTDDDLREMFKPYGEIGDIFSNPEKNFTFLRLDYYQNAEKAKRA 319
            ||.|:..|....|::|.:..:..:.||..:.||:.|:..:..|..:...|:::.....||...:.
Yeast   329 LPPDHIKVYSRTLFIGGVPLNMKEWDLANVLKPFAEVQSVILNNSRKHAFVKVYSRHEAENVLQN 393

  Fly   320 L--DGSLRKGRVLRVR----FAP 336
            .  ||:|    .||.|    |.|
Yeast   394 FNKDGAL----PLRTRWGVGFGP 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nonA-lNP_001262646.1 RRM1_p54nrb_like 264..334 CDD:240778 17/75 (23%)
RRM2_p54nrb_like 339..418 CDD:240779
NOPS_NONA_like 409..508 CDD:240580
OmpH <479..578 CDD:281871
DUF4472 479..559 CDD:291409
NRD1NP_014148.1 CID_Nrd1_like 8..149 CDD:340781
RRM_NRD1_SEB1_like 336..412 CDD:409768 19/79 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23189
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.