DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment nonA-l and Rbm4b

DIOPT Version :9

Sequence 1:	NP_001262646.1	Gene:	nonA-l / 42026	FlyBaseID:	FBgn0015520	Length:	630	Species:	Drosophila melanogaster
Sequence 2:	NP_079993.2	Gene:	Rbm4b / 66704	MGIID:	1913954	Length:	357	Species:	Mus musculus

Alignment Length:	141	Identity:	38/141 - (26%)
Similarity:	64/141 - (45%)	Gaps:	22/141 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   266 RLYVGNLTSDTTDDDLREMFKPYGEI--GDIFSNPEKNFTFLRLDYYQNAEKAKRALDGSLRKGR 328
            :|::|||..:.|:.::|.:|:.||::  .||.    ||:.|:.::....||.|.|.|......|.
Mouse     3 KLFIGNLPREATEQEIRSLFEQYGKVLECDII----KNYGFVHIEDKTAAEDAIRNLHHYKLHGV 63

  Fly   329 VLRVRFAPN-----AIVRVTNLNQFVSNELLHQSFEIFGPIERAVICVD------DRGKHTGEGI 382
            .:.|..:.|     ..:.|.|::...:|:.|...||.:||:....|..|      :|.:...|.|
Mouse    64 NINVEASKNKSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAI 128

  Fly   383 -----VEFAKK 388
                 .||..|
Mouse   129 RGLDNTEFQGK 139

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
nonA-l	NP_001262646.1	RRM1_p54nrb_like	264..334	CDD:240778	21/69 (30%)
		RRM2_p54nrb_like	339..418	CDD:240779	16/61 (26%)
		NOPS_NONA_like	409..508	CDD:240580
		OmpH	<479..578	CDD:281871
		DUF4472	479..559	CDD:291409
Rbm4b	NP_079993.2	RRM1_RBM4	2..68	CDD:241050	20/68 (29%)
		RRM2_RBM4	78..144	CDD:241051	16/62 (26%)
		PTZ00368	<145..>181	CDD:173561
		ZnF_C2HC	161..176	CDD:197667
		Interaction with TNPO3. /evidence=ECO:0000250	196..357
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910