DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nonA-l and RBM15

DIOPT Version :9

Sequence 1:NP_001262646.1 Gene:nonA-l / 42026 FlyBaseID:FBgn0015520 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_073605.4 Gene:RBM15 / 64783 HGNCID:14959 Length:977 Species:Homo sapiens


Alignment Length:476 Identity:93/476 - (19%)
Similarity:152/476 - (31%) Gaps:169/476 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SPLPQRQQRGNSTNKNLGKPTPPKLNAASDGNPAEKKARLGGNTQNGGGVAGGGGTGGGGGGGGA 77
            ||:..::.||...:.:.|                |:..:|||:     |.:.|..:|....|||:
Human    51 SPVKAKRSRGGEDSTSRG----------------ERSKKLGGS-----GGSNGSSSGKTDSGGGS 94

  Fly    78 TGGVEFSRNRNRGGNQNENRQGFQVANNSHQKQINESPKPAAGNVPAKNNELSAGGGGQNQPNHS 142
            ...:...::.:|||::.     :.....|...:::....|:..|        |:|||   :...|
Human    95 RRSLHLDKSSSRGGSRE-----YDTGGGSSSSRLHSYSSPSTKN--------SSGGG---ESRSS 143

  Fly   143 NKGQGNQGDQGEQGNQGPNFRGRGGGPNQPNQNANQEQSNGYPGNQGDNKG-------------- 193
            ::|.|     ||..:.|......|||.....:.....:......::....|              
Human   144 SRGGG-----GESRSSGAASSAPGGGDGAEYKTLKISELGSQLSDEAVEDGLFHEFKRFGDVSVK 203

  Fly   194 -------GQGQ-----------RGAGGGKHQRGNR--------------SRRSGGS--------- 217
                   |.|.           ..|...||.||..              |||...|         
Human   204 ISHLSGSGSGDERVAFVNFRRPEDARAAKHARGRLVLYDRPLKIEAVYVSRRRSRSPLDKDTYPP 268

  Fly   218 --GIMNSSM--------GGGGQRG----------EDFFIAQRLLDISGPTHELPPIELPTDNK-- 260
              .::.:|:        ||||||.          .|:.:.|..|....|.   ||..||.|.:  
Human   269 SASVVGASVGGHRHPPGGGGGQRSLSPGGAALGYRDYRLQQLALGRLPPP---PPPPLPRDLERE 330

  Fly   261 ----FVGRNR-----------------------------------LYVGNLTSDTTDDDLREMFK 286
                |..|.|                                   |::|||....|:.|||..|.
Human   331 RDYPFYERVRPAYSLEPRVGAGAGAAPFREVDEISPEDDQRANRTLFLGNLDITVTESDLRRAFD 395

  Fly   287 PYGEIGDI-FSNPEKNFT----FLRLDYYQNAEKAKRALDGSLRKGRVLRVRF---APNAIVRVT 343
            .:|.|.:: ...|.:..|    ||:.:....:.:||.|:.|.:.....:::.:   .|...:.|.
Human   396 RFGVITEVDIKRPSRGQTSTYGFLKFENLDMSHRAKLAMSGKIIIRNPIKIGYGKATPTTRLWVG 460

  Fly   344 NLNQFVSNELLHQSFEIFGPI 364
            .|..:|....|.:.|:.||.|
Human   461 GLGPWVPLAALAREFDRFGTI 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nonA-lNP_001262646.1 RRM1_p54nrb_like 264..334 CDD:240778 21/109 (19%)
RRM2_p54nrb_like 339..418 CDD:240779 8/26 (31%)
NOPS_NONA_like 409..508 CDD:240580
OmpH <479..578 CDD:281871
DUF4472 479..559 CDD:291409
RBM15NP_073605.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..167 34/157 (22%)
RRM1_RBM15 169..251 CDD:409969 8/81 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..298 8/41 (20%)
RRM2_RBM15 367..453 CDD:409971 19/85 (22%)
RRM3_RBM15 456..528 CDD:409973 8/26 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 555..778
SF-CC1 624..>736 CDD:273721
SPOC 781..954 CDD:400205
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 865..884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154199
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.