DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nonA-l and rbm14b

DIOPT Version :9

Sequence 1:NP_001262646.1 Gene:nonA-l / 42026 FlyBaseID:FBgn0015520 Length:630 Species:Drosophila melanogaster
Sequence 2:XP_021333123.1 Gene:rbm14b / 402858 ZFINID:ZDB-GENE-040426-2455 Length:560 Species:Danio rerio


Alignment Length:159 Identity:49/159 - (30%)
Similarity:74/159 - (46%) Gaps:18/159 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 RLYVGNLTSDTTDDDLREMFKPYGEIGDIFSNPEKNFTFLRLDYYQNAEKAKRALDGSLRKGRVL 330
            :|:||||..|||.::|..:|:.||::  :..:..:.|.|:.|.....||:|.|.|:|...|||.|
Zfish     8 KLFVGNLALDTTQEELSAIFESYGQV--VSCSVLRQFAFVHLQGEGAAERAIRELNGREFKGRNL 70

  Fly   331 -----RVRFAPNAIVRVTNLNQFVSNELLHQSFEIFGPIERAVICVDDRGKHTGEGIVEFAKKSS 390
                 |.|...:..|.|.||:...:.|.|.:.|:.||   :.:.|  |:.|  |...|....|..
Zfish    71 VVEES
RGRPLHSTKVFVGNLSSMCTTEDLQELFQTFG---KVLEC--DKVK--GYAFVHMENKED 128

  Fly   391 ASACLRLCNEKCFFLTASLRPCLVEPMEV 419
            |...:...:...|    ..||..||..:|
Zfish   129 ALQAIEALHGTSF----KGRPLSVELSKV 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nonA-lNP_001262646.1 RRM1_p54nrb_like 264..334 CDD:240778 26/72 (36%)
RRM2_p54nrb_like 339..418 CDD:240779 21/78 (27%)
NOPS_NONA_like 409..508 CDD:240580 5/11 (45%)
OmpH <479..578 CDD:281871
DUF4472 479..559 CDD:291409
rbm14bXP_021333123.1 RRM1_CoAA 7..75 CDD:241052 25/68 (37%)
RRM1_2_CoAA_like 84..149 CDD:240789 19/75 (25%)
AIR1 <150..>187 CDD:331526 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.