DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nonA-l and rbm4b

DIOPT Version :9

Sequence 1:NP_001262646.1 Gene:nonA-l / 42026 FlyBaseID:FBgn0015520 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_989204.1 Gene:rbm4b / 394812 XenbaseID:XB-GENE-494431 Length:338 Species:Xenopus tropicalis


Alignment Length:114 Identity:31/114 - (27%)
Similarity:56/114 - (49%) Gaps:11/114 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 RLYVGNLTSDTTDDDLREMFKPYGEIG--DIFSNPEKNFTFLRLDYYQNAEKAKRALDGSLRKGR 328
            :|:||||..:.|..:|:.:|:.:|.:.  ||.    ||:.|:.::..:.|::|...|:.......
 Frog     3 KLFVGNLPPEATQSELKSLFEQFGRVTECDII----KNYGFVHMEDRKAADEAVHNLNHYKLHSV 63

  Fly   329 VLRV---RFAPNAIVR--VTNLNQFVSNELLHQSFEIFGPIERAVICVD 372
            .:.|   |..|.|..:  |:||:...::|.|...||.:|.:....|..|
 Frog    64 PINVE
HSRGKPKASTKLHVSNLSTSCTSEELRAKFEEYGAVLECDIVKD 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nonA-lNP_001262646.1 RRM1_p54nrb_like 264..334 CDD:240778 18/72 (25%)
RRM2_p54nrb_like 339..418 CDD:240779 10/36 (28%)
NOPS_NONA_like 409..508 CDD:240580
OmpH <479..578 CDD:281871
DUF4472 479..559 CDD:291409
rbm4bNP_989204.1 RRM_SF 2..68 CDD:388407 17/68 (25%)
RRM_SF 78..144 CDD:388407 10/35 (29%)
ZnF_C2HC 161..176 CDD:197667
COG5222 <162..>201 CDD:227547
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.