powered by:
Protein Alignment nonA-l and lark
DIOPT Version :9
Sequence 1: | NP_001262646.1 |
Gene: | nonA-l / 42026 |
FlyBaseID: | FBgn0015520 |
Length: | 630 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_523957.1 |
Gene: | lark / 38811 |
FlyBaseID: | FBgn0011640 |
Length: | 352 |
Species: | Drosophila melanogaster |
Alignment Length: | 74 |
Identity: | 21/74 - (28%) |
Similarity: | 45/74 - (60%) |
Gaps: | 2/74 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 266 RLYVGNLTSDTTDDDLREMFKPYGEIGDIFSNPEKNFTFLRLDYYQNAEKAKRALDGSLRKGRVL 330
:::|||||..|...::||:|:.||.: :..:..:|:.|:.||...:.:.|.:.|:|.:..|:.|
Fly 87 KIFVGNLTDKTRAPEVRELFQKYGTV--VECDIVRNYGFVHLDCVGDVQDAIKELNGRVVDGQPL 149
Fly 331 RVRFAPNAI 339
:|:.:.:.:
Fly 150 KVQVSTSRV 158
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.