DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nonA-l and lark

DIOPT Version :9

Sequence 1:NP_001262646.1 Gene:nonA-l / 42026 FlyBaseID:FBgn0015520 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster


Alignment Length:74 Identity:21/74 - (28%)
Similarity:45/74 - (60%) Gaps:2/74 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 RLYVGNLTSDTTDDDLREMFKPYGEIGDIFSNPEKNFTFLRLDYYQNAEKAKRALDGSLRKGRVL 330
            :::|||||..|...::||:|:.||.:  :..:..:|:.|:.||...:.:.|.:.|:|.:..|:.|
  Fly    87 KIFVGNLTDKTRAPEVRELFQKYGTV--VECDIVRNYGFVHLDCVGDVQDAIKELNGRVVDGQPL 149

  Fly   331 RVRFAPNAI 339
            :|:.:.:.:
  Fly   150 KVQVSTSRV 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nonA-lNP_001262646.1 RRM1_p54nrb_like 264..334 CDD:240778 21/67 (31%)
RRM2_p54nrb_like 339..418 CDD:240779 0/1 (0%)
NOPS_NONA_like 409..508 CDD:240580
OmpH <479..578 CDD:281871
DUF4472 479..559 CDD:291409
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 20/66 (30%)
hnRNP-R-Q <88..>258 CDD:273732 21/73 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.