DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nonA-l and Raver2

DIOPT Version :9

Sequence 1:NP_001262646.1 Gene:nonA-l / 42026 FlyBaseID:FBgn0015520 Length:630 Species:Drosophila melanogaster
Sequence 2:XP_038966220.1 Gene:Raver2 / 362551 RGDID:1307610 Length:785 Species:Rattus norvegicus


Alignment Length:425 Identity:98/425 - (23%)
Similarity:150/425 - (35%) Gaps:115/425 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LSAGGGGQNQPNHSNKGQGNQG-DQGEQGNQGPNFR----GRG---GG----------------- 168
            ::.|..|..:|..:.:.:|:.| ......:..|.||    |||   ||                 
  Rat    29 VAPGAPGFERPGRARRARGSVGTGSSPTTSPSPRFRRCPAGRGRSIGGVAVQGVSLSSAPPASVA 93

  Fly   169 -----PNQPNQNANQEQSN-----GYPGNQGDNKGGQGQRGAGGGKHQRGNRSRRSGGSGIMNSS 223
                 |.:|...:...:..     ..|...|.::...|:|..||...:||     ..|.||....
  Rat    94 AAPPPPARPCSASGPPRPRAASPLSLPLRSGLSESAAGRREDGGAGRRRG-----GPGLGIRTLC 153

  Fly   224 MGGGGQRGEDFFIAQRLLDISGPTHELPPIELPTDNKFVGRNRLYVGNLT--SDTTDDDLREMFK 286
            ..|||.||      .|... .|.....||                .|..|  :|.|..:..|   
  Rat   154 WDGGGGRG------ARAAP-GGGGCAAPP----------------GGGCTAAADATGAEQPE--- 192

  Fly   287 PYGEIGDIFSNP-EKNFTFLRLDYY---QNAEKAKRALDG----SLRKGRVLRVRFAP-NAIVRV 342
                     .|| ||.....:|..:   .|.|:|:.|:..    |.| ||.|.|:..| :|::.:
  Rat   193 ---------ENPGEKPAPGQQLPAFVTLLNGEQAQSAIQRFHQFSFR-GRELTVQLQPTDALLCI 247

  Fly   343 TNLNQFVSNELLHQSFEIFGPIERAVICVDD-RGKHTGEGIVEFAKKS-SASACLRLCNEKCFFL 405
            |||....:.|...:....:|.|||..:...: .|...|.|.||:.||. :|.|.|.|...:   :
  Rat   248 TNLPVSFTLEEFEELVRAYGNIERCFLVYSEVTGHSKGYGFVEYMKKDFAAKARLELLGRQ---M 309

  Fly   406 TASLRPCLVEPMEVNNDNDGLPDKTLNKKSLEFRHERSVGPRFACLNSFEHEYGSRWKQLHDLFK 470
            .||  ....:.|:||.    |..:.::.|.|             |::....:| |..::|..||.
  Rat   310 GAS--ALFAQWMDVNL----LASELIHSKCL-------------CIDKLPSDY-SDSEELLQLFS 354

  Fly   471 SKQDSLKRELKMEEDKLE---AQMEYARYEQETEL 502
            |....:..:|..:|....   |.:||:..|...|:
  Rat   355 SIHKPVFCQLAQDEGSHGGGFAVVEYSTAEHAEEV 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nonA-lNP_001262646.1 RRM1_p54nrb_like 264..334 CDD:240778 20/79 (25%)
RRM2_p54nrb_like 339..418 CDD:240779 21/80 (26%)
NOPS_NONA_like 409..508 CDD:240580 20/97 (21%)
OmpH <479..578 CDD:281871 7/27 (26%)
DUF4472 479..559 CDD:291409 7/27 (26%)
Raver2XP_038966220.1 RRM_SF <207..240 CDD:418427 10/33 (30%)
RRM2_RAVER2 244..320 CDD:410067 21/80 (26%)
RRM3_RAVER2 330..426 CDD:410069 16/74 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347818
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.