DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17562 and CG14893

DIOPT Version :10

Sequence 1:NP_650566.1 Gene:CG17562 / 42021 FlyBaseID:FBgn0038449 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_650568.2 Gene:CG14893 / 42023 FlyBaseID:FBgn0038451 Length:510 Species:Drosophila melanogaster


Alignment Length:165 Identity:36/165 - (21%)
Similarity:57/165 - (34%) Gaps:66/165 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 GNSEIEEKIEKQMSVEKNISIEQFFGENQKSTRNSDQNAKN---HEEDPE--------------- 124
            ||:||  :|:..:||...:....:      |||.|....||   .|..||               
  Fly    19 GNTEI--RIQSGISVYVRVHFCTY------STRCSSPLWKNIIPFEVIPEFPFVFEEYFTRPTLP 75

  Fly   125 -----------SDDE----ETAYLNLIRSF-------KKEESMH----DLKNASGKLPSSN--CE 161
                       :|:|    |...:.|.|.|       |.:..:|    ::.:.:.:..|.:  |:
  Fly    76 NVIFTISIYDINDEEPLGLEQIVVPLTRHFSNFTVHTKNDSFLHFAVRNVCDENWRTHSCSIFCK 140

  Fly   162 DEISIDEFHDSESNGKCSEEEDEDESYLIQLKYFG 196
            |.        |:|..||    |:|:.|.....|.|
  Fly   141 DR--------SDSKFKC----DDDDGYKCAPGYSG 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17562NP_650566.1 FAR-N_SDR_e 12..329 CDD:187547 36/165 (22%)
Sterile 363..452 CDD:460779
CG14893NP_650568.2 FAR-N_SDR_e 23..339 CDD:187547 33/161 (20%)
Sterile 374..465 CDD:460779
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.