DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17562 and CG1441

DIOPT Version :10

Sequence 1:NP_650566.1 Gene:CG17562 / 42021 FlyBaseID:FBgn0038449 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_610535.1 Gene:CG1441 / 36029 FlyBaseID:FBgn0033464 Length:517 Species:Drosophila melanogaster


Alignment Length:187 Identity:33/187 - (17%)
Similarity:62/187 - (33%) Gaps:70/187 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 SYLIQLKYF-----------GGSGKPLEQGQEKPTSAETNEGFNIDEKPDEMKNNYETDSVENVQ 240
            ||....|:.           .|.|...||.|..||             |..:...:...:||..:
  Fly    57 SYCTSAKFLHCRHVRLFSAVSGKGSGNEQQQNAPT-------------PQLLSKLFPQTAVEGTE 108

  Fly   241 KGETEEEKRKRLSEEERLSA----EF--------LASLDQKTI--------DAD----------- 274
             .|.::||.::..|.|:.|:    :|        :::....|:        ||:           
  Fly   109 -NEQQQEKHRKEEEAEKESSWKRMKFGFVFFGFSVSAFCVYTVWVFGAPDRDAEGNIIVDEFMEL 172

  Fly   275 --------RLRHNLNHREKIKEEAERQQLEPE------MQKSYNNDYRQSSINSHQD 317
                    |:..::.:.:|:.:|..|::|.|:      :|..|........:..|.|
  Fly   173 PTFQQYFRRMWKSMTYYQKMIQEPSREKLLPDPLKYPYVQPPYTLVLEMKDVLVHPD 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17562NP_650566.1 FAR-N_SDR_e 12..329 CDD:187547 33/187 (18%)
Sterile 363..452 CDD:460779
CG1441NP_610535.1 FAR-N_SDR_e 35..348 CDD:187547 33/187 (18%)
Sterile 384..475 CDD:460779
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.