DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10340 and atpaf1

DIOPT Version :9

Sequence 1:NP_650565.2 Gene:CG10340 / 42020 FlyBaseID:FBgn0022344 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001008070.1 Gene:atpaf1 / 493432 XenbaseID:XB-GENE-948200 Length:303 Species:Xenopus tropicalis


Alignment Length:248 Identity:91/248 - (36%)
Similarity:136/248 - (54%) Gaps:26/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EDNPYYSKYASKIAKLQQTSAEEFLDRVERVVNPIKDGQSQARSYSELLNPKQKLQAEQAAEL-- 102
            ::||||.||..||.:|::|:...|..|:::    .|:.:.|...||:        |||.|..:  
 Frog    47 DENPYYGKYRDKIQQLRRTNPSAFDARLDK----RKELKQQPLGYSK--------QAEFAKTVEE 99

  Fly   103 -----------PHKKLTDIMKLELIEDKTAEEVSQIWLEYHKTKEVLAATLSTSQYENLMARAKE 156
                       .:|.|..|:.:|||:||.|:|:.:||.:|...:..:.|.:....:|.:..|||.
 Frog   100 KVGTASGKGFSKNKTLDSILNIELIKDKDADEIREIWKQYFSLRNSVYAVIPGESFELIWRRAKT 164

  Fly   157 HPVFLLPLPRSEGFEFVMLQFAANTVHFTPLLAYQVHHENAPECLTVVHYTEVQ-DKGVVLMRGE 220
            .|.||..|||.||:||.:.|::.:.:|||.|:..|...:.||..|.:.||.|.| |||:|||..|
 Frog   165 CPSFLYALPRKEGYEFFVGQWSGSELHFTALINIQTAGDAAPSQLILYHYPEFQKDKGIVLMTSE 229

  Fly   221 YDTKVLTAQEAQCLANELQMFYLKPDEGKLRLLNTFTRKPDEFKHMDLIKEVE 273
            .|||.|..|:||||||::|:||.........|:..|..|.||||:|.::..:|
 Frog   230 IDTKFLNVQDAQCLANQVQLFYGSDGAETFGLVEKFNHKSDEFKYMAVVSFLE 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10340NP_650565.2 ATP11 29..271 CDD:284139 90/244 (37%)
atpaf1NP_001008070.1 ATP11 54..279 CDD:284139 86/236 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 142 1.000 Domainoid score I4651
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41492
Inparanoid 1 1.050 156 1.000 Inparanoid score I4188
OMA 1 1.010 - - QHG53243
OrthoDB 1 1.010 - - D1108259at2759
OrthoFinder 1 1.000 - - FOG0004966
OrthoInspector 1 1.000 - - otm49060
Panther 1 1.100 - - LDO PTHR13126
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5399
SonicParanoid 1 1.000 - - X5300
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.