DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10340 and atp11

DIOPT Version :9

Sequence 1:NP_650565.2 Gene:CG10340 / 42020 FlyBaseID:FBgn0022344 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_593338.1 Gene:atp11 / 2541713 PomBaseID:SPAC3A12.12 Length:286 Species:Schizosaccharomyces pombe


Alignment Length:252 Identity:70/252 - (27%)
Similarity:126/252 - (50%) Gaps:33/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NPYYSKYASKIAKLQQTSAEEFLDRVERVVNPIKDGQSQARSYSELLNPKQKLQAEQAAELPHKK 106
            |..|.:|..|:    ::.|||.   ...|.|.:|.||::.|   |.:.||:...|:::....:.|
pombe    45 NTVYERYERKL----KSKAEEL---HMPVTNLLKKGQTKER---EHVIPKKSFSAKKSLVGQNAK 99

  Fly   107 LTDI------MKLELIEDKTAEEVSQIWLEYHKTKEVLAATLSTSQYENLMARAKEHPVFLLPLP 165
            .:|:      :.:|.|::.....:.::|...:...::|:|.:....||.:::||:.:|.|:||||
pombe   100 KSDLSGLNRYIDVEKIKELPTSTIEKLWRARNIGDDILSACIPKEIYEKMLSRARMYPYFVLPLP 164

  Fly   166 RSE-GFEFVMLQF---AANTVHF--TPLLAYQVHHENAPECLTVVHYTEVQD-KGVVLMRGEYDT 223
            |.: |.|...||:   ..|..|.  |.||.|::....|.....::|:.::.: ||:.|||.:::.
pombe   165 RGDKGIESHFLQWNFPNKNEAHLLVTSLLEYKLKGSYAAPHTIMLHFADLLNLKGITLMRCQFEP 229

  Fly   224 KVLTAQEAQCLANELQMFYLKPDE---GK--LRLLNTFTRKPD-----EFKHMDLIK 270
            |.|:|.:.|.|...:|.||...:.   ||  |.||..|::..|     ...|||:::
pombe   230 KKLSANDVQLLVLAIQKFYNASENTPLGKERLALLAAFSKGADFDLHKVATHMDMLE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10340NP_650565.2 ATP11 29..271 CDD:284139 70/252 (28%)
atp11NP_593338.1 ATP11 48..278 CDD:284139 66/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 78 1.000 Domainoid score I2402
eggNOG 1 0.900 - - E1_KOG3281
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I1847
OMA 1 1.010 - - QHG53243
OrthoFinder 1 1.000 - - FOG0004966
OrthoInspector 1 1.000 - - oto101757
orthoMCL 1 0.900 - - OOG6_102875
Panther 1 1.100 - - LDO PTHR13126
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5399
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.