DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10340 and Atpaf1

DIOPT Version :9

Sequence 1:NP_650565.2 Gene:CG10340 / 42020 FlyBaseID:FBgn0022344 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_851383.2 Gene:Atpaf1 / 230649 MGIID:2180560 Length:348 Species:Mus musculus


Alignment Length:242 Identity:81/242 - (33%)
Similarity:135/242 - (55%) Gaps:10/242 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EDNPYYSKYASKIAKLQQTSAEEFLDRVER----VVNPIKDGQSQARSYSELLNPKQKLQAEQAA 100
            |.||:|.:|..||.:|:::....|..|:|:    ...|:  |.|:...:.:.:..|.....:|..
Mouse    92 EANPFYDRYRDKIQQLRRSDPAAFESRLEKRSEFRKQPV--GHSKQSDFIKCMEQKTDALGKQPV 154

  Fly   101 E---LPHKKLTDIMKLELIEDKTAEEVSQIWLEYHKTKEVLAATLSTSQYENLMARAKEHPVFLL 162
            .   ...|.|:.:..:|:::||||||:.|||.:|...|:.:.|.:...:::.:..||:..|.||.
Mouse   155 SKGFTKDKTLSSVFNVEMVKDKTAEEIKQIWQQYFSAKDTVYAVIPKEKFDLIWNRAQSCPTFLC 219

  Fly   163 PLPRSEGFEFVMLQFAANTVHFTPLLAYQVHHENAPECLTVVHYTEV-QDKGVVLMRGEYDTKVL 226
            .|||.:|:||.:.|:....:|||.|:..|...:.|...|.:.||.|: ::||:|||..|.|:..|
Mouse   220 ALPRRDGYEFFVGQWTGTELHFTALINIQTRGDAAASQLILYHYPELKEEKGIVLMTAEMDSTFL 284

  Fly   227 TAQEAQCLANELQMFYLKPDEGKLRLLNTFTRKPDEFKHMDLIKEVE 273
            ...||||:||::|:||....:....|:.||..:|:|||:|.:|.|:|
Mouse   285 NVVEAQCIANQVQLFYATDRKEIYGLVETFNFRPNEFKYMSVIAELE 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10340NP_650565.2 ATP11 29..271 CDD:284139 79/238 (33%)
Atpaf1NP_851383.2 ATP11 97..329 CDD:284139 76/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842646
Domainoid 1 1.000 141 1.000 Domainoid score I4707
eggNOG 1 0.900 - - E1_KOG3281
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41492
Inparanoid 1 1.050 151 1.000 Inparanoid score I4349
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53243
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004966
OrthoInspector 1 1.000 - - oto94523
orthoMCL 1 0.900 - - OOG6_102875
Panther 1 1.100 - - LDO PTHR13126
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5399
SonicParanoid 1 1.000 - - X5300
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.