DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10345 and CD36

DIOPT Version :9

Sequence 1:NP_650563.2 Gene:CG10345 / 42017 FlyBaseID:FBgn0027562 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_000063.2 Gene:CD36 / 948 HGNCID:1663 Length:472 Species:Homo sapiens


Alignment Length:456 Identity:117/456 - (25%)
Similarity:204/456 - (44%) Gaps:65/456 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RNAKLLRSAALGMTLLFFGSLVI-ISDPL-QSILDTQLSLKPGTLLHRLWLLPPLDVYINVYMFN 72
            ||..|:..|.:|..|..||.::: :.|.| |..:..|:.|:.||:..:.|:....:||...::|:
Human     5 RNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFD 69

  Fly    73 YTNVDEFTSGRASKLQLQEVGPYVYK-EVLSNHNVTYNESNNTITYSPKREYVFAPERSVGDPKI 136
            ..|..|... .:|.:|:::.|||.|: ..|:..|||.:..:||:::......:|.|..|||    
Human    70 VQNPQEVMM-NSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVG---- 129

  Fly   137 DRIRAPNIPLMGVTTLASS---LSMFAALGLSAITRQLNSQPMLEMSVHDYMWGYEDHLVELASR 198
              ..|.|..::.:...|:|   .:.|..:.|:::..:..|......::.:.:|||.|..:.|...
Human   130 --TEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPY 192

  Fly   199 FVPNWIDFSSFGIMEKLFREGNES-----NVFNMNLPEPKDKYGMRMTDAPRGYTVDSINGERGF 258
            .|...:.         ||...|.:     .|||     .||       :..:...:|:..|:|..
Human   193 PVTTTVG---------LFYPYNNTADGVYKVFN-----GKD-------NISKVAIIDTYKGKRNL 236

  Fly   259 KGWQYNEETNGTMCNRIWGSHDATLFPLDMDENDEFFLYRRTFCRRLPVKFNRTTTFNGLDAFEF 323
            ..|:       :.|:.|.|: ||..||..::::.....:....||.:...|.......|:..:.|
Human   237 SYWE-------SHCDMINGT-DAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRF 293

  Fly   324 VMEPDSFDSEVDNANSSCYCK----NNRCLKKGVGNVSPCYYNIPLAITYPHFMHADPSLLEPFD 384
            |:...:|.|.|:|.::.|:|.    :..|...||.::|.|....|:.|:.|||::|.|.:.||.|
Human   294 VLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPID 358

  Fly   385 GLQPNVSRFTSTFVVQPQLGAPMQGTHLRLQANQVV---GKV----NFNRMMTPFENMILPLLWV 442
            ||.||.....:...::|..|..:|... |||.|.:|   .|:    |..|      |.|:|:||:
Human   359 GLNPNEEEHRTYLDIEPITGFTLQFAK-RLQVNLLVKPSEKIQVLKNLKR------NYIVPILWL 416

  Fly   443 D 443
            :
Human   417 N 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10345NP_650563.2 CD36 21..488 CDD:279474 113/445 (25%)
CD36NP_000063.2 CD36 14..463 CDD:395898 113/447 (25%)
Required for interaction with thrombospondins, THBS1 and THBS2. /evidence=ECO:0000269|PubMed:1371676 93..120 7/26 (27%)
Interaction with PTK2, PXN and LYN. /evidence=ECO:0000269|PubMed:20037584 460..472
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X155
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.