DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10345 and Snmp1

DIOPT Version :9

Sequence 1:NP_650563.2 Gene:CG10345 / 42017 FlyBaseID:FBgn0027562 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001262803.1 Gene:Snmp1 / 42514 FlyBaseID:FBgn0260004 Length:551 Species:Drosophila melanogaster


Alignment Length:505 Identity:120/505 - (23%)
Similarity:209/505 - (41%) Gaps:77/505 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLRSAALGMTLLFFGSLVIISDPLQSILDTQLSLKPGTLLHRLWLLPPLDVYINVYMFNYTNVDE 78
            |:.|.|:.:..:.:| .||....|:.::..|::||||:.:..||...|..::..:|:||.||.||
  Fly     9 LMGSGAMFVFAIIYG-WVIFPKILKFMISKQVTLKPGSDVRELWSNTPFPLHFYIYVFNVTNPDE 72

  Fly    79 FTSGRASKLQLQEVGPYVYKEVLSNHNVTYNESNNTITYSPKREYVFAPERSVGDPKIDRIRAPN 143
            .:.|  :|.:||||||:|:.|....:::..:...:|::::.:..::|.|:.|             
  Fly    73 VSEG--AKPRLQEVGPFVFDEWKDKYDLEDDVVEDTVSFTMRNTFIFNPKES------------- 122

  Fly   144 IPLMGVTTLASSLSMFAALGLSAITRQLNSQPMLEMSVHDYMWGYEDHLVELASRFVPNW----- 203
            :||.|...:.....:....|:|.   |.....|:|:........:.|....|.::|:..:     
  Fly   123 LPLTGEEEIILPHPIMLPGGISV---QREKAAMMELVSKGLSIVFPDAKAFLKAKFMDLFFRGIN 184

  Fly   204 IDFSSFGIMEK----LFREGNESNVFNMNLPEPKDKYGMRMTDAPRG-YTVDSINGERGFKG--- 260
            :|.||.....|    :|..|.......:|.......:..:...:..| :||.     ||.|.   
  Fly   185 VDCSSEEFSAKALCTVFYTGEIKQAKQVNQTHFLFSFMGQANHSDSGRFTVC-----RGVKNNKK 244

  Fly   261 ---------------WQYNEETNGTMCNRIWGSHDATLFPLDMDENDEFFLYRRTFCRRLPVKFN 310
                           |...|      ||...|: |:|:|...:.:.|..:.:....||.|...:.
  Fly   245 LGKVVKFADEPEQDIWPDGE------CNTFVGT-DSTVFAPGLKKEDGLWAFTPDLCRSLGAYYQ 302

  Fly   311 RTTTFNGLDAFEFVMEPDSFDSEVDNANSSCYCKN----NRCLKKGVGNVSPCYYNIPLAITYPH 371
            ..::::|:.:..:.:  |..|...|. ...|:|::    :.|..||..|::.|... ||..:.||
  Fly   303 HKSSYHGMPSMRYTL--DLGDIRADE-KLHCFCEDPEDLDTCPPKGTMNLAACVGG-PLMASMPH 363

  Fly   372 FMHADPSLLEPFDGLQPNVSRFTSTFVVQPQLGAPMQGTHLRLQANQVVGKVNFNRMMTPFENMI 436
            |...||.|:...|||.||..........:...|.|.|... |||.|..:..|.....|.....:|
  Fly   364 FYLGDPKLVADVDGLNPNEKDHAVYIDFELMSGTPFQAAK-RLQFNLDMEPVEGIEPMKNLPKLI 427

  Fly   437 LPLLWVD----LNIDVLCLTLRLLIHGIKWGFPLLQWS----AALGMLLA 478
            ||:.||:    ||.....|....|..|:|.. .:|:||    :.:|::.:
  Fly   428 LPMFWVEEGVQLNKTYTNLVKYTLFLGLKIN-SVLRWSLITFSLVGLMFS 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10345NP_650563.2 CD36 21..488 CDD:279474 117/498 (23%)
Snmp1NP_001262803.1 CD36 12..478 CDD:279474 119/502 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450735
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11923
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.