DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG34458

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:396 Identity:91/396 - (22%)
Similarity:132/396 - (33%) Gaps:150/396 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 TSTATLSWLCLLLLLPSSRQFETDCGCRPARRGPRIIAGAATNEGQFPWQASLELLHPSLGFLGH 110
            :|...|..|.:|||..:....:.|     .....|||.|.....||||.|.||:|..      .|
  Fly     2 SSVNNLVKLSILLLAVTFVHSDMD-----VAEESRIIGGQFAAPGQFPHQVSLQLNG------RH 55

  Fly   111 WCGAVLIHQYWILSAAHCVHNDLFNLPIPPLWTVVLGEHDRDVESGNEQRIPVEKIVMHHRYH-- 173
            .||..||....|::||||....     .|.....::|.:  |:.:||.|...:.:.::|.||:  
  Fly    56 HCGGSLISDTMIVTAAHCTMGQ-----NPGQMKAIVGTN--DLSAGNGQTFNIAQFIIHPRYNPQ 113

  Fly   174 NFKHDVVLMKLSKPADLTRASNIRRICLPFLLAESPDQAQSETVSPPSSADEDVLIQQLELEDVP 238
            :...|:.|:|||.|..:..|                                   :|.::|.|  
  Fly   114 SQDFDMSLIKLSSPVPMGGA-----------------------------------VQTIQLAD-- 141

  Fly   239 EKIDNFLRSVQSRRRYRNVTAPSMKELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRR 303
                                                                            .
  Fly   142 ----------------------------------------------------------------S 142

  Fly   304 DSDDSAEQKHPKVSDEPKEIAFVDCVATGWGKANISGDLSNQLLKTQVPLHQNGRCRDAYGSFVN 368
            ||:.:|:..               .:.:|:|..|.:..|.|:|...||.|.....|...     |
  Fly   143 DSNYAADTM---------------AMISGFGAINQNLQLPNRLKFAQVQLWSRDYCNSQ-----N 187

  Fly   369 IHG---GHLCAGKLNGEGGTCVGDSGGPLQCRLSRDGPWILVGVTSFGSGCALEGFPDVYTRTSY 430
            |.|   ..:|||..:|:..:|.||||||    |:.||.  |.||.|:|.||..:|.|.:||....
  Fly   188 IPGLTDRMVCAGHPSGQVSSCQGDSGGP----LTVDGK--LFGVVSWGFGCGAKGRPAMYTYVGA 246

  Fly   431 YMKWIE 436
            ...||:
  Fly   247 LRSWIK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 82/359 (23%)
Tryp_SPc 81..438 CDD:238113 83/361 (23%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 82/359 (23%)
Tryp_SPc 32..254 CDD:238113 83/361 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.