DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG11313

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:379 Identity:86/379 - (22%)
Similarity:134/379 - (35%) Gaps:144/379 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 RIIAGAATNEGQFPWQASLELLHPSLGFLGHWCGAVLIHQYWILSAAHCV-------HNDL-FNL 136
            :|..|..|...:|.|...||........|..:|...||:..::::|||||       ..|: |.:
  Fly   115 QITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRV 179

  Fly   137 PIPPLWTVVLGEHDRD--VESGNEQRIP------VEKIVMHHRYHN--FKHDVVLMKLSKPADLT 191
                  :|.||||:..  |:..|.:.:|      ||:|.:|..:..  |.:|:.|::|::  ::.
  Fly   180 ------SVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIALIRLAR--EVA 236

  Fly   192 RASNIRRICLPFLLAESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRN 256
            .:.:||.:|||            .||.                          |::.||.:.:  
  Fly   237 YSPSIRPVCLP------------STVG--------------------------LQNWQSGQAF-- 261

  Fly   257 VTAPSMKELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPKVSDEPK 321
                                                                             
  Fly   262 ----------------------------------------------------------------- 261

  Fly   322 EIAFVDCVATGWGKANISGDLSNQLLKTQVPLHQNGRCRDAYGSFVNIHGGHLCA-GKLNGEGGT 385
                   ...|||: .::.:.|...:|.:|...:.|.||..|.|.|.:...|||| |:..|:  :
  Fly   262 -------TVAGWGR-TLTSESSPVKMKLRVTYVEPGLCRRKYASIVVLGDSHLCAEGRSRGD--S 316

  Fly   386 CVGDSGGPLQCRLSRDGPWILVGVTSFGSGCALEGFPDVYTRTSYYMKWIEDTI 439
            |.|||||||..  ..:|.|:|.|:.|||..|....:|.|||....|..||...|
  Fly   317 CDGDSGGPLMA--FHEGVWVLGGIVSFGLNCGSRFWPAVYTNVLSYETWITQNI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 83/373 (22%)
Tryp_SPc 81..438 CDD:238113 85/375 (23%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 85/375 (23%)
Tryp_SPc 116..364 CDD:214473 83/372 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.