DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG9733

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:444 Identity:104/444 - (23%)
Similarity:155/444 - (34%) Gaps:153/444 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QSRPKSRLQSRPQSRSQSLSQSQCHWQIPATSTATLSWLCLLLLLPSSRQFETDCGCRPARRGPR 80
            :.||:|.:..|.:.|..|........:.|...::|.....||...||       ||....|.  |
  Fly   106 EERPQSFVFPRQERRPWSFGNQPATSRTPFRKSSTSDGSSLLPQPPS-------CGGVGIRN--R 161

  Fly    81 IIAGAATNEGQFPWQASLELLHPSLGFLGHWCGAVLIHQYWILSAAHCVHNDLFNLPIPPLWTVV 145
            |..|..|:..:|||...||....|...|...|...||::.::|:||||:...: ...:..|.:|.
  Fly   162 IYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRI-EREVGTLVSVR 225

  Fly   146 LGEHDR----DVESG------NEQRIPVEKIVMHHRY----HNFKHDVVLMKLSKPADLTRASNI 196
            |||||.    |...|      ..||:..|:|.:|.||    .|..||:.|:::.:  ::..:.||
  Fly   226 LGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMER--NVRYSDNI 288

  Fly   197 RRICLPFLLA-ESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRNVTAP 260
            :.||||..:. ||....|..||:                                          
  Fly   289 QPICLPSSVGLESRQSGQQFTVA------------------------------------------ 311

  Fly   261 SMKELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPKVSDEPKEIAF 325
                                                                             
  Fly   312 ----------------------------------------------------------------- 311

  Fly   326 VDCVATGWGKANISGDLSNQLLKTQVPLH--QNGRCRDAYGSF-VNIHGGHLCAGKLNGE--GGT 385
                  |||:   :..::...:|.:|.::  ...:||..:... ||:....||||   |:  ..:
  Fly   312 ------GWGR---TLKMARSAVKQKVTVNYVDPAKCRQRFSQIKVNLEPTQLCAG---GQFRKDS 364

  Fly   386 CVGDSGGPLQCRLSRDGPWILVGVTSFGSGCALEGFPDVYTRTSYYMKWIEDTI 439
            |.|||||||.  ..||..|:|.|:.|||..|.|:.:|.|||..:.|..||...:
  Fly   365 CDGDSGGPLM--RFRDESWVLEGIVSFGYKCGLKDWPGVYTNVAAYDIWIRQNV 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 87/374 (23%)
Tryp_SPc 81..438 CDD:238113 88/376 (23%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 87/374 (23%)
Tryp_SPc 162..415 CDD:238113 88/376 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.