DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG11836

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:376 Identity:85/376 - (22%)
Similarity:138/376 - (36%) Gaps:139/376 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 DCGCRPARRGPRIIAGAATNEGQFPWQASLELLHPSLGFLGHW-CGAVLIHQYWILSAAHCVHND 132
            ||.|..:....||:.|..|...|:||.|.:.       :.|.: ||..|:.:.::||||||| ..
  Fly    85 DCDCGFSNEEIRIVGGKPTGVNQYPWMARIV-------YDGKFHCGGSLLTKDYVLSAAHCV-KK 141

  Fly   133 LFNLPIPPLWTVVLGEHDRDVESGNE--QRIPVEKIVMHHRY--HNFKHDVVLMKLSKPADLTRA 193
            |....|    .|:.|:||:::.|.::  || .|..::.|..:  ..:.:|:.|::|.||...::.
  Fly   142 LRKSKI----RVIFGDHDQEITSESQAIQR-AVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKI 201

  Fly   194 SNIRRICLPFLLAESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRNVT 258
              |:.||||                                                        
  Fly   202 --IKPICLP-------------------------------------------------------- 208

  Fly   259 APSMKELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPKVSDEPKEI 323
                                           |...|...::|                       
  Fly   209 -------------------------------RYNYDPAGRIG----------------------- 219

  Fly   324 AFVDCVATGWGKANISGDLSNQLLKTQVPLHQNGRCRDAYGSFVNIHGGHLCAGKLNGEGGTCVG 388
                 ...|||:.:..|:|.:.:.:.:||:.....||:.......|....||||:.:.:  :|.|
  Fly   220 -----TVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAGRPSMD--SCQG 277

  Fly   389 DSGGPLQCRLSRDGPWILVGVTSFGSGCALEGFPDVYTRTSYYMKWIEDTI 439
            ||||||  .||....:.:||:.|:|.||..||:|.||:|.|.::.||:..:
  Fly   278 DSGGPL--LLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 80/359 (22%)
Tryp_SPc 81..438 CDD:238113 81/361 (22%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 81/361 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.