DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG7142

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:370 Identity:72/370 - (19%)
Similarity:120/370 - (32%) Gaps:149/370 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 PWQASLELLHPSLGFLGHWCGAVLIHQYWILSAAHC------VHNDLFNLPIPPLWTVVLGEHDR 151
            |:..|::::.|..| |.|:|...:|:::|||:||||      |.|.:          :|.|.||.
  Fly    92 PYVVSIQMMTPDQG-LVHYCAGTIINEHWILTAAHCLSSPQAVENSV----------IVAGSHDI 145

  Fly   152 DVESGNEQRIPVEKIVMHHRYHNF-----KHDVVLMKLSKPADLTRASNIRRICLPFLLAESPDQ 211
            ..:.|....|.:..|..:.|:..:     .:|:.|:...:|             |.|        
  Fly   146 HDQKGEASNIQMRHIDYYVRHELYLGGVNPYDIALIYTKEP-------------LVF-------- 189

  Fly   212 AQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRNVTAPSMKELMNMKILSRMRQ 276
                          |..:|...|                                          
  Fly   190 --------------DTYVQPATL------------------------------------------ 198

  Fly   277 ALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPKVSDEPKEIAFVDCVATGWGKANISG- 340
                                    |.:|:             :|:...    ...|||..:::. 
  Fly   199 ------------------------PEQDA-------------QPEGYG----TLYGWGNVSMTAV 222

  Fly   341 -DLSNQLLKTQVPLHQNGRCRDAYG-SFVNIHGGHLCAGKLNGEGGTCVGDSGGPL---QCRLSR 400
             :..::|.:..:|:.....|..... |.:.:|..:||.|.|.|....|..||||||   .|....
  Fly   223 PNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHF 287

  Fly   401 DGPWILVGVTSFGS-GCALEGFPDVYTRTSYYMKWIEDTI--ATH 442
            :...|::|:.|:|. .|..:..|.|:.|.|.:.:||...|  |||
  Fly   288 EQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVISTATH 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 66/359 (18%)
Tryp_SPc 81..438 CDD:238113 68/362 (19%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 68/362 (19%)
Tryp_SPc 84..323 CDD:214473 66/359 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.