DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG31266

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:390 Identity:87/390 - (22%)
Similarity:132/390 - (33%) Gaps:155/390 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LPSSRQFETDCGCRPARRGPRIIAGAATNEGQFPWQASLELLHPSLGFLGHWCGAVLIHQYWILS 124
            ||.....|.........:| |:|.|....||.:||.||::     ..:..|.|||:::.:.|:|:
  Fly    32 LPGLANIERHRSTEAVPQG-RVIGGTTAAEGNWPWIASIQ-----NAYSYHLCGAIILDETWVLT 90

  Fly   125 AAHCVHNDLFNLPIPPL-WTVVLGEHD-RDVESGNEQRIPVEKIVMHHR-----YHNFKHDVVLM 182
            ||.||..      :.|| ..||.|..| .|:.:   ....|.:|.:|..     |||   |:.|:
  Fly    91 AASCVAG------LRPLNLLVVTGTVDWWDLYA---PYYTVSQIHVHCNFDKPLYHN---DIALL 143

  Fly   183 KLSKPADLTRASNIRRICLPFLLAESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRS 247
            :||                                            .::|..||.         
  Fly   144 QLS--------------------------------------------SKIEFNDVT--------- 155

  Fly   248 VQSRRRYRNVTAPSMKELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQK 312
                   :|:|...:.||                         ...|||                
  Fly   156 -------KNITLADIDEL-------------------------EEGDKL---------------- 172

  Fly   313 HPKVSDEPKEIAFVDCVATGWGKANISGDLSNQLLK---TQVPLHQNGRCRDAYGSFVNIHGGHL 374
                            ...|||.:...|.....|.:   |.:|:   ..||:...:..::..||:
  Fly   173 ----------------TFAGWGSSEAMGTYGRYLQEASGTYLPV---DACREKLQNQDDVDLGHV 218

  Fly   375 CAGKLNGEGGTCVGDSGGPLQCRLSRDGPWILVGVTSFGSGCALEGFPDVYTRTSYYMKWIEDTI 439
            |. :::...|.|.||:||||.....|     |||:.::|..|. .|:||||.||::|..||..|:
  Fly   219 CV-QMDAGQGACHGDTGGPLIDEQQR-----LVGIGNWGVPCG-RGYPDVYARTAFYHDWIRTTM 276

  Fly   440  439
              Fly   277  276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 80/364 (22%)
Tryp_SPc 81..438 CDD:238113 81/366 (22%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 80/364 (22%)
Tryp_SPc 52..275 CDD:238113 81/366 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.