DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and ea

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:459 Identity:109/459 - (23%)
Similarity:153/459 - (33%) Gaps:194/459 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SQSQTQSRPKSRLQSRPQSRSQSLSQSQCHWQIPATSTATLSWLCLLLLLPSSRQFETDCGCRPA 75
            |.|:|...||      |...|.|                       ||.||.      .||...:
  Fly    96 SSSETTPPPK------PNVTSNS-----------------------LLPLPG------QCGNILS 125

  Fly    76 RRGPRIIAGAATNEGQFPWQASLELLHPSLGFLGHWCGAVLIHQYWILSAAHCVHNDLFNLPIPP 140
            .   ||..|..|...:|||.|.:|.. .|.|..||.||..||...::::|:|||:..    .:|.
  Fly   126 N---RIYGGMKTKIDEFPWMALIEYT-KSQGKKGHHCGGSLISTRYVITASHCVNGK----ALPT 182

  Fly   141 LWT---VVLGEHDRDVESGNE-------------QRIPVEKIVMHHRY----HNFKHDVVLMKLS 185
            .|.   |.|||.|.:.....|             ..:|||:.:.|..|    .|..:|:.|::|:
  Fly   183 DWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRLA 247

  Fly   186 KPADLTRASNIRRICLPFLLAESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQS 250
            :..:.|  ..:|.||||                                      :|..|||.  
  Fly   248 QQVEYT--DFVRPICLP--------------------------------------LDVNLRSA-- 270

  Fly   251 RRRYRNVTAPSMKELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPK 315
              .:..:|                                                         
  Fly   271 --TFDGIT--------------------------------------------------------- 276

  Fly   316 VSDEPKEIAFVDCVATGWGKA-NISGDLSNQLLKTQVPLHQNGRCRDAYGS-FVNIHGGHLCAGK 378
                 .::|       ||||. .:|.  ||..||..|...:...|::.|.| .:.:....:||| 
  Fly   277 -----MDVA-------GWGKTEQLSA--SNLKLKAAVEGFRMDECQNVYSSQDILLEDTQMCAG- 326

  Fly   379 LNGEGG--TCVGDSGGPLQCRLSRDGP-----WILVGVTSFG-SGCALEGFPDVYTRTSYYMKWI 435
              |:.|  :|.|||||||   :..|..     :.|.||.||| :.|.|.|:|.|||....|:.||
  Fly   327 --GKEGVDSCRGDSGGPL---IGLDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWI 386

  Fly   436 EDTI 439
            ::||
  Fly   387 QNTI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 91/384 (24%)
Tryp_SPc 81..438 CDD:238113 92/386 (24%)
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 91/384 (24%)
Tryp_SPc 128..389 CDD:238113 92/386 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.