DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG3916

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:394 Identity:92/394 - (23%)
Similarity:140/394 - (35%) Gaps:141/394 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LSWLCLLLLLPSSRQFETDCGCRPARRGPRIIAGAATNEGQFPWQASLELLHPSLGFLGHWCGAV 115
            |...|:||:|   ||...|..........||..|...|| ..|:|.||::  ...|...|:||..
  Fly     4 LQLFCMLLIL---RQGLADVVTSTTESPTRINGGQRVNE-TVPFQVSLQM--QRRGRWQHFCGGS 62

  Fly   116 LIHQYWILSAAHCVHNDLFNLPIPPLWTVVLGEHDRDVESGNEQRIPVEKIVMHHRYH---NFKH 177
            ::....:|:||||:.    .:.:..: :||:|  ..:.::|..:...|.|.| |.:|.   ...:
  Fly    63 IVSGQHVLTAAHCME----KMKVEDV-SVVVG--TLNWKAGGLRHRLVTKHV-HPQYSMNPRIIN 119

  Fly   178 DVVLMKLSKPADLTRASNIRRICLPFLLAESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKID 242
            |:.|:|::.|..|.| |:|..|.:          ..|:.:.                |.||.::.
  Fly   120 DIALVKVTPPFRLER-SDISTILI----------GGSDRIG----------------EKVPVRLT 157

  Fly   243 NFLRSVQSRRRYRNVTAPSMKELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDD 307
            .:           ..|:||..                         |....|:|..|..|..|::
  Fly   158 GW-----------GSTSPSTS-------------------------SATLPDQLQALNYRTISNE 186

  Fly   308 SAEQKHPKVSDEPKEIAFVDCVATGWGKANISGDLSNQLLKTQVPLHQNGRCRDAYGSFVNIHGG 372
            ...||..:|:                                                     ..
  Fly   187 DCNQKGFRVT-----------------------------------------------------RN 198

  Fly   373 HLCAGKLNGEGGTCVGDSGGPLQCRLSRDG--PWILVGVTSFGSGCALEGFPDVYTRTSYYMKWI 435
            .:||..:.|: |.||||||||    |.|.|  |. |||:.|:||....:|.||||||.|.::.:|
  Fly   199 EICALAVQGQ-GACVGDSGGP----LIRPGKQPH-LVGIVSYGSSTCAQGRPDVYTRVSSFLPYI 257

  Fly   436 EDTI 439
            ...|
  Fly   258 SQVI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 82/359 (23%)
Tryp_SPc 81..438 CDD:238113 82/361 (23%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 82/359 (23%)
Tryp_SPc 31..260 CDD:238113 82/361 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.