DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG17404

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:392 Identity:87/392 - (22%)
Similarity:124/392 - (31%) Gaps:163/392 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SSRQFETDCGCRPARRGP-RIIAGAATNEGQ-FPWQASLELLHPSLGFLGHWCGAVLIHQYWILS 124
            :|||        |:...| ||:.||....|: .|:|.||:  :.:.|...|:||..:|....||:
  Fly    23 NSRQ--------PSGYTPHRIVGGADIPPGEHVPYQVSLQ--YRTRGGQMHFCGGSIIAPNRILT 77

  Fly   125 AAHCVHNDLFNLPIPPLWTVVLGEHDRDVESGNEQ--RIPVEKIVMHHRYHNF-KHDVVLMKLSK 186
            ||||...  .|   ....:||.|     :...||:  |..|....:|.:|... ..|:.::.: |
  Fly    78 AAHCCQG--LN---ASRMSVVAG-----IRGLNEKGSRSQVLSYSIHPKYQELVTSDLAVLSI-K 131

  Fly   187 PADLTRASNIRRICLPFLLAESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQSR 251
            |                                                  |.|::|   |..|.
  Fly   132 P--------------------------------------------------PLKLNN---STISA 143

  Fly   252 RRYRNVTAPSMKELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPKV 316
            ..||:                                                            
  Fly   144 IEYRS------------------------------------------------------------ 148

  Fly   317 SDEPKEI--AFVDCVATGWGKA---------NISGDLSNQLLKTQVPLHQNGRCRDAYGSFVNIH 370
              :.|:.  ..|....||||..         |:  :..|.|.:.......|..||:|  ...::.
  Fly   149 --QGKDFVGGGVPVTLTGWGLRLPVPFPFLDNV--NYPNVLQRMSYHTISNSECRNA--GMESVT 207

  Fly   371 GGHLCA-GKLNGEGGTCVGDSGGPLQCRLSRDGPWILVGVTSFG-SGCALEGFPDVYTRTSYYMK 433
            ...:|| |...   |.|.|||||||... |::| ...||:.|:| ..|.|...||||||.|.:..
  Fly   208 DTEICARGPFR---GACSGDSGGPLVME-SKNG-LQQVGIVSYGLVVCGLYISPDVYTRVSTFSD 267

  Fly   434 WI 435
            ||
  Fly   268 WI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 80/371 (22%)
Tryp_SPc 81..438 CDD:238113 81/372 (22%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 80/371 (22%)
Tryp_SPc 35..269 CDD:238113 79/370 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.