DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG6865

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:377 Identity:91/377 - (24%)
Similarity:134/377 - (35%) Gaps:140/377 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 RGPRIIAGAATNEGQFPWQASLELLHPSLGFLGHWCGAVLIHQYWILSAAHCVHNDLFNLPIPPL 141
            |.|:|:.|:.....:.|:..||      :...||:||..:|.:.|||:|.||:.|.|.....|..
  Fly    31 RNPKIVGGSEAERNEMPYMVSL------MRRGGHFCGGTIISERWILTAGHCICNGLQQFMKPAQ 89

  Fly   142 WTVVLGEHD-RDVESG-----NEQRIPVEKIVMHHRY--HNFKHDVVLMKLSKPADLTRASNIRR 198
            ...|:|.|. |:..:|     :..|:..:.||.|.:|  ::.|||:.|::|.:|  :..:|:|:.
  Fly    90 IQGVVGLHSIREYLNGIGNGPDALRVDFKNIVPHPQYDCNDVKHDIALLELVQP--IRFSSHIQP 152

  Fly   199 ICLPFLLAESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRNVTAPSMK 263
            .|:                                                              
  Fly   153 SCV-------------------------------------------------------------- 155

  Fly   264 ELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPKVSDEPKEIAFVDC 328
                             .|...|:                    |.||::..||           
  Fly   156 -----------------GSEEGHR--------------------SLEQEYGTVS----------- 172

  Fly   329 VATGWG---KANISGDLSNQLLKTQVPLHQNGRCRDAY---GSFVNIHGGHLCAGKLNGEGGTCV 387
               |||   :.....|.|:.|.|..|.:..|..|..:|   |....|....||||..||:..:|.
  Fly   173 ---GWGWTHENQAENDRSDVLRKATVKIWNNEACERSYRSLGKSNTIGETQLCAGYENGQIDSCW 234

  Fly   388 GDSGGPLQCRLSRDGPWILVGVTSFGSGCALEGFPDVYTRTSYYMKWIEDTI 439
            .||||||..:...     ||||.|.|.|||..|.|.:|||.|.|:.|::..|
  Fly   235 ADSGGPLMSKEHH-----LVGVVSTGIGCARPGLPGIYTRVSKYVSWMQKVI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 87/368 (24%)
Tryp_SPc 81..438 CDD:238113 88/370 (24%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 87/367 (24%)
Tryp_SPc 35..280 CDD:238113 88/370 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.