DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG4914

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster


Alignment Length:489 Identity:108/489 - (22%)
Similarity:153/489 - (31%) Gaps:220/489 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SQTQSRPKSRLQSRPQSRSQSLSQSQCHWQIPATSTATLSWLCLLLLLP---------------- 61
            |.|.:.|.:...|.|                |||||||.|    |..:|                
  Fly    26 SATPATPATPATSAP----------------PATSTATSS----LSSIPGKYQALGAAHHQAKKL 70

  Fly    62 ------------------------------------SSRQFETDCGCRPARRG--PRIIAGAATN 88
                                                :..|....|.||...|.  .||:.|..|.
  Fly    71 KIGDVNASSSDANKPVFRQNPIKNWFGAFNRNNSPAAQNQTSPTCSCRCGERNDESRIVGGTTTG 135

  Fly    89 EGQFPWQASLELLHPSLGFLGHWCGAVLIHQYWILSAAHCVHNDLFNLPIPPLW---TVVLGEHD 150
            ..::||.|.|..      |...:||..||:..::|:|||||...        :|   .|..||||
  Fly   136 VSEYPWMARLSY------FNRFYCGGTLINDRYVLTAAHCVKGF--------MWFMIKVTFGEHD 186

  Fly   151 RDVESGNEQRIPVEKIVMH-----HRYHNFKHDVVLMKLSKPADLTRASNIRRICLPFLLAESPD 210
            |    .|::..|..:.|:.     ..:.||.:|:.|::|:....:|  |.||.||||        
  Fly   187 R----CNDKERPETRFVLRAFSQKFSFSNFDNDIALLRLNDRVPIT--SFIRPICLP-------- 237

  Fly   211 QAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRNVTAPSMKELMNMKILSRMR 275
                                                                             
  Fly   238 ----------------------------------------------------------------- 237

  Fly   276 QALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPKVSDEPKEIAFVDCVATGWGKANISG 340
                        |..:|.|  :.:|.:                         .:|||||.....|
  Fly   238 ------------RVEQRQD--LFVGTK-------------------------AIATGWGTLKEDG 263

  Fly   341 DLSNQLLKTQVPLHQNGRCRDAYGSFVN--IHGGHLCAGKLNGEGG--TCVGDSGGPLQCRLSRD 401
            ..|..|.:.:||:..|..| .|..::..  |....:|:| ..|.||  :|.|||||||......|
  Fly   264 KPSCLLQEVEVPVLDNDEC-VAQTNYTQKMITKNMMCSG-YPGVGGRDSCQGDSGGPLVRLRPDD 326

  Fly   402 GPWILVGVTSFGSGCALEGFPDVYTRTSYYMKWI 435
            ..:..:|:.|:|:|||...:|.||||.:.|:.||
  Fly   327 KRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWI 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 86/366 (23%)
Tryp_SPc 81..438 CDD:238113 87/367 (24%)
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 86/366 (23%)
Tryp_SPc 128..363 CDD:238113 87/367 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.