DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG4613

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster


Alignment Length:365 Identity:85/365 - (23%)
Similarity:125/365 - (34%) Gaps:147/365 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 RIIAGAATNEGQFPWQASLELLHPSLGFLGHWCGAVLIHQYWILSAAHCVHN-DLFNLPIPPLWT 143
            ||:.|......::||.|  :::..:..|    ||..||:..::|:||||||. |:..:      :
  Fly   136 RIVGGTQVRTNKYPWIA--QIIRGTFLF----CGGTLINDRYVLTAAHCVHGMDMRGV------S 188

  Fly   144 VVLGEHDRDVESGNEQRIPVEKIVMHHRYH------NFKHDVVLMKLSKPADLTRASNIRRICLP 202
            |.|.:.||     :...:.|.:.|.....|      :..||:.|::|.:|..|  ...:|..|||
  Fly   189 VRLLQLDR-----SSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPL--VDTMRPACLP 246

  Fly   203 FLLAESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRNVTAPSMKELMN 267
                                                   .|:|::..                  
  Fly   247 ---------------------------------------SNWLQNFD------------------ 254

  Fly   268 MKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPKVSDEPKEIAFVDCVATG 332
                                                                     |...:..|
  Fly   255 ---------------------------------------------------------FQKAIVAG 262

  Fly   333 WGKANISGDLSNQLLKTQVPLHQNGRCR-DAYGSFVNIHGGHLCAGKL-NGEGGTCVGDSGGPLQ 395
            ||.:...|..|:.|.:..||:..|.:|| .:|.|.  |....:|||.: .|....|.||||||| 
  Fly   263 WGLSQEGGSTSSVLQEVVVPIITNAQCRATSYRSM--IVDTMMCAGYVKTGGRDACQGDSGGPL- 324

  Fly   396 CRLSRDGPWILVGVTSFGSGCALEGFPDVYTRTSYYMKWI 435
              :.||..:.|.||.|||.|||....|.||||.|.|::||
  Fly   325 --IVRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 83/363 (23%)
Tryp_SPc 81..438 CDD:238113 84/364 (23%)
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 83/363 (23%)
Tryp_SPc 137..362 CDD:238113 82/362 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.