DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG4477

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_648295.1 Gene:CG4477 / 39058 FlyBaseID:FBgn0035971 Length:315 Species:Drosophila melanogaster


Alignment Length:342 Identity:54/342 - (15%)
Similarity:100/342 - (29%) Gaps:138/342 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 FLG--HWCGAVLIHQYWILSAAHCVHNDLFNLPIPPLWTVVLGEHDRDVESGNEQRIPVEKIVMH 169
            |.|  |:|..|::...:::::|||:.|....|....:..:|.|                      
  Fly    65 FFGDNHFCSGVILAPMFVMTSAHCLINKRRVLISSRVLLIVAG---------------------- 107

  Fly   170 HRYHNFKHDVVLMKLSKPADLTRASNIRRICLP--FLLAESPDQAQSETVSPPSSADEDVLIQQL 232
                      .|.:|....:.|..:.:..|.||  |.:....|....:..:|....:|.:.|.:|
  Fly   108 ----------TLNRLKYIPNRTFVTPVTHIWLPDSFTMRNKQDFGLLKVKNPFPRNNEHISIARL 162

  Fly   233 ELEDVPEKIDNFLRSVQSRRRYRNVTAPSMKELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLM 297
            .:                                                               
  Fly   163 PV--------------------------------------------------------------- 164

  Fly   298 KLGPRRDSDDSAEQKHPKVSDEPKEIAFVDCVATGWGKANISGDLSNQLLKTQVPLHQNGRCRDA 362
                           ||.:..       :.|...|||:....|.|::.:|...|.:..:..|   
  Fly   165 ---------------HPPLPG-------LKCKVMGWGRMYKGGPLASYMLYIDVQVIDSEAC--- 204

  Fly   363 YGSFVNIHG-GHLCAGKLNGEGGT----CVGDSGGPLQCRLSRDGPWILVGVTSFGSGCALEGFP 422
             ..::.:.. .|:||  ::.:..|    |.||.|.|    :..:|  .:.|:.:..:||.:...|
  Fly   205 -AKWLRVPSVEHVCA--VDSDDLTAQQPCGGDWGAP----MLHNG--TVYGIVTILAGCGVSHLP 260

  Fly   423 DVYTRTSYYMKWIEDTI 439
            .:||.......||.:.|
  Fly   261 SLYTNVHSNANWIHEKI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 51/336 (15%)
Tryp_SPc 81..438 CDD:238113 53/339 (16%)
CG4477NP_648295.1 Tryp_SPc 55..276 CDD:238113 53/339 (16%)
Tryp_SPc 55..273 CDD:214473 51/336 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.