DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG14990

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:378 Identity:80/378 - (21%)
Similarity:123/378 - (32%) Gaps:172/378 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 GQFPWQASLELLHPSLGF-LGHWCGA-VLIHQYWILSAAHCVHNDLFNLPIPPLWTVVLGEHDRD 152
            |||||..:|        | .|.:.|| .||....:|:||                ::|:|:.|.:
  Fly    70 GQFPWVVAL--------FSQGKYFGAGSLIAPEVVLTAA----------------SIVVGKTDAE 110

  Fly   153 --VESG------------NEQRIPVEKIVMHHRYHNF--KHDVVLMKLSKPADLTRASNIRRICL 201
              |.:|            :|.| ||.::|.|..:...  .:::.|:.|:.|.:|  .|:||.|||
  Fly   111 IVVRAGEWNTGQRSEFLPSEDR-PVARVVQHREFSYLLGANNIALLFLANPFEL--KSHIRTICL 172

  Fly   202 PFLLAESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRNVTAPSMKELM 266
            |                                                                
  Fly   173 P---------------------------------------------------------------- 173

  Fly   267 NMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPKVSDEPKEIAFVDCVAT 331
                                  |:.|               |.:||.              |:.|
  Fly   174 ----------------------SQGR---------------SFDQKR--------------CLVT 187

  Fly   332 GWGKANISGD-LSNQLLKTQVPLHQNGRCRD-----AYGSFVNIHGGHLCAGKLNGE--GGTCVG 388
            ||||...:.: .||...|.::|:....:|:|     ..|...::....:|||   ||  .|.|:|
  Fly   188 GWGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAG---GEKDAGDCLG 249

  Fly   389 DSGGPLQCRLSRD-GPWILVGVTSFGSGCALEGFPDVYTRTSYYMKWIEDTIA 440
            |.|..|.|.:..| ..:...|:.::|.||..|..|.|||....:..||.:.:|
  Fly   250 DGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWIYEHMA 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 77/371 (21%)
Tryp_SPc 81..438 CDD:238113 79/374 (21%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 79/374 (21%)
Tryp_SPc 67..297 CDD:214473 77/371 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.