DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG30414

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:406 Identity:78/406 - (19%)
Similarity:124/406 - (30%) Gaps:171/406 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ETDCGCRPARRGPRIIAGAATNEGQFPWQASLELLHPSLGFLGH-WCGAVLIHQYWILSAAHCVH 130
            ::.||.......|.|..||.......||...:         ||. .||..||...::|:||||:.
  Fly    27 DSSCGTTKPEFIPMITGGADAGLFSNPWMVKV---------LGEKLCGGSLITSRFVLTAAHCIV 82

  Fly   131 NDLFNLPIPPLWT-------------------VVLGEHD-----RDVESGNEQRIPVEKIVMHHR 171
            :....:.:....|                   :.|||:|     :|........:.|::.::|..
  Fly    83 STHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSYELAVDRKILHAD 147

  Fly   172 YH-NFKHDVVLMKLSKPADLTRASNIRRICL--PFLLAESPDQAQSETVSPPSSADEDVLIQQLE 233
            |: |..:|:.|:::.  :.:..:..:|.|||  ...:||||                        
  Fly   148 YNLNLDNDIGLLRMK--SFVQYSDYVRPICLLVEGHMAESP------------------------ 186

  Fly   234 LEDVPEKIDNFLRSVQSRRRYRNVTAPSMKELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMK 298
                                           :.|:                              
  Fly   187 -------------------------------IFNI------------------------------ 190

  Fly   299 LGPRRDSDDSAEQKHPKVSDEPKEIAFVDCVATGWGKANISGDLSNQLLKTQV---PLHQNGRCR 360
                                            ||||..| .|..|.:|.:..|   .||   .||
  Fly   191 --------------------------------TGWGVTN-DGTPSRRLQRATVYNTDLH---FCR 219

  Fly   361 DAYGSFVNIHGGHLCAGKLNGEGGTCVGDSGGPLQCRLSRDGPWIL--VGVTSFGSGCALEGFPD 423
            ..:..  .:....:||...|.:  .|.|||||||..::...|.|:.  .|:.|:|| .|...| .
  Fly   220 SKFTK--QVDESQICAAGTNSD--ACHGDSGGPLSAQVPFAGSWLTFQYGLVSYGS-AACHSF-S 278

  Fly   424 VYTRTSYYMKWIEDTI 439
            |||..:::..||.:.|
  Fly   279 VYTNVTHHRDWIVNAI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 72/387 (19%)
Tryp_SPc 81..438 CDD:238113 74/389 (19%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 72/386 (19%)
Tryp_SPc 41..290 CDD:238113 72/386 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.