DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and Prss48

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001001650.1 Gene:Prss48 / 368202 MGIID:2685865 Length:312 Species:Mus musculus


Alignment Length:406 Identity:101/406 - (24%)
Similarity:150/406 - (36%) Gaps:147/406 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 ATLSWLCLLLL------LPSSRQFETDCGCRPARRGPRIIAGAATNEGQFPWQASLELLHPSLGF 107
            |.|..|.||.|      ....:..::.|| ||...| ||:.|.....|::|||.||...:.    
Mouse     4 AGLKVLLLLFLGAFQGSFTKKKNLQSVCG-RPVHTG-RIVGGQDAALGRWPWQVSLRFDYT---- 62

  Fly   108 LGHWCGAVLIHQYWILSAAHCVHNDLFNLPIPPLWTVVLGEHDRDVESGNEQRIPVEKIVMHHRY 172
              |.||..||..:|:|:||||:....::.    |::|.||..||:..|..::.. |.:|.:..::
Mouse    63 --HSCGGSLISDHWVLTAAHCIKKTWYSF----LYSVWLGSIDREYSSTGKEYY-VSRIAIPDKH 120

  Fly   173 HNFKHDVVLMKLSKPADLTRASNIRRICLPFLLAESPDQAQSETVSPPSSADEDVLIQQLELEDV 237
            .:.:.|:.|:|||  :.:|.:|.|..||||.:         |:.::.|:|               
Mouse   121 RHTEADIALLKLS--SRVTFSSVILPICLPNI---------SKQLTVPAS--------------- 159

  Fly   238 PEKIDNFLRSVQSRRRYRNVTAPSMKELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPR 302
                                                                             
Mouse   160 ----------------------------------------------------------------- 159

  Fly   303 RDSDDSAEQKHPKVSDEPKEIAFVDCVATGWGKANISGDLSNQLLKTQVPLHQNGRCRDAY---G 364
                                     |..||||: |..|...:.|.:.:||:..:..|...|   |
Mouse   160 -------------------------CWVTGWGQ-NQEGHYPSTLQELEVPVISSEACEQLYNPIG 198

  Fly   365 SFVN-----IHGGHLCAGKLNGEGGTCVGDSGGPLQCRLSRDGPWILVGVTSFGSGCALEGFPDV 424
            .|:.     |.....|||:......:|.|||||||.|.:  ||.|.|:||.|:|..|. :..|.|
Mouse   199 VFLPDLERVIKEDMFCAGERQSRKDSCKGDSGGPLSCHI--DGVWRLMGVVSWGLECG-KDLPGV 260

  Fly   425 YTRTSYYMKWIEDTIA 440
            ||..:||.|||...|:
Mouse   261 YTNVTYYQKWISAIIS 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 87/362 (24%)
Tryp_SPc 81..438 CDD:238113 88/364 (24%)
Prss48NP_001001650.1 Tryp_SPc 39..271 CDD:214473 87/362 (24%)
Tryp_SPc 40..274 CDD:238113 88/364 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H133731
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.