DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG18563

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster


Alignment Length:123 Identity:32/123 - (26%)
Similarity:53/123 - (43%) Gaps:14/123 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 CVATGWGKANISGDLSNQ--LLKTQVPLHQNGRC-----RDAYGSFVNIHGGHLCA-GKLNGEGG 384
            |...||...: |.|.|..  :.|.::.:.....|     ....|...::|...:|| .::|.:  
  Fly   258 CTVAGWDLVS-SHDQSRMRIIKKLELTVLDRTTCVAQFRNTTLGRNFDLHPSLICARSEINRD-- 319

  Fly   385 TCVGDSGGPLQCRLSRDGPWIL--VGVTSFGSGCALEGFPDVYTRTSYYMKWIEDTIA 440
            .|.|..|..|.|.|..:.|.:.  .|:.::|.||.|: .|.:||..:.:..||.:.||
  Fly   320 FCFGGGGYALFCSLGDENPHVFEQAGIVAWGMGCGLD-LPGIYTNVAMFRSWIYNRIA 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 28/116 (24%)
Tryp_SPc 81..438 CDD:238113 30/119 (25%)
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 30/118 (25%)
Tryp_SPc 147..371 CDD:214473 28/116 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.