DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG18478

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster


Alignment Length:373 Identity:78/373 - (20%)
Similarity:116/373 - (31%) Gaps:157/373 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 EGQ-----FPWQASLELLHPSLGFLGHWCGAVLIHQYWILSAAHCVHNDLFNLPIPPLWTVVLGE 148
            |||     |||  ::.::| :...:|   |..||....:|:|||    .:||..:..: .|..||
  Fly    47 EGQAKPAEFPW--TIAVIH-NRSLVG---GGSLITPDIVLTAAH----RIFNKDVEDI-VVSAGE 100

  Fly   149 HDRDVESGNE-QRIPVE-----KIVMH--HRYHNFKHDVVLMKLSKPADLTRASNIRRICLPFLL 205
            .    |.|:. ::.|.|     |:|:|  ..|....:::.|:.|.:...||  ..|..||||   
  Fly   101 W----EYGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLT--YKINTICLP--- 156

  Fly   206 AESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRNVTAPSMKELMNMKI 270
                                            .:|     ||:.|.|                  
  Fly   157 --------------------------------TQK-----RSLSSTR------------------ 166

  Fly   271 LSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPKVSDEPKEIAFVDCVATGWGK 335
                                                                     |:..||||
  Fly   167 ---------------------------------------------------------CIVAGWGK 174

  Fly   336 ANISG-DLSNQLLKTQVPLHQNGRCRD-----AYGSFVNIHGGHLCAGKLNGE--GGTCVGDSGG 392
            ...|. .....|.|..:|:.....|:|     ..|....:..|.:|||   ||  ...|.||.||
  Fly   175 YQFSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLPRGLICAG---GEKDNDACTGDGGG 236

  Fly   393 PLQCRLSRD-GPWILVGVTSFGSGCALEGFPDVYTRTSYYMKWIEDTI 439
            .|.|.::.| ..:..:|:.::|.||..:..|..||....:..||...|
  Fly   237 ALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWIVQQI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 75/367 (20%)
Tryp_SPc 81..438 CDD:238113 77/370 (21%)
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 74/367 (20%)
Tryp_SPc 50..280 CDD:214473 72/364 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.