DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and l(2)k05911

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:461 Identity:105/461 - (22%)
Similarity:152/461 - (32%) Gaps:176/461 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSQSQLHSQSQTQSRPKSRLQSRPQSRSQSLSQSQCHWQIPATSTATLSWLCLLLLLP----SSR 64
            |:...:.|..:|..||.|  .:||.:..:....|   :..|.|:|.|..       .|    ||.
  Fly   329 PTTGGVPSTKRTTPRPTS--PARPTTTRRPTYPS---YPSPVTTTTTTR-------RPVSGTSSE 381

  Fly    65 QFETDCGCRPARRGP------RIIAGAATNEGQFPWQASLELLHPSLGFLG--HWCGAVLIHQYW 121
            .....||    .:.|      ||:.|...:..:|||.|.|        |..  .:||..||....
  Fly   382 GLPLQCG----NKNPVTPDQERIVGGINASPHEFPWIAVL--------FKSGKQFCGGSLITNSH 434

  Fly   122 ILSAAHCVHNDLFNLPIPPLWTV-VLGEHDRDVESGNEQRIP-----VEKIVMHHRY-----HNF 175
            ||:|||||..       ...|.| .|..|..|...|.:..:.     ::::|.|..:     || 
  Fly   435 ILTAAHCVAR-------MTSWDVAALTAHLGDYNIGTDFEVQHVSRRIKRLVRHKGFEFSTLHN- 491

  Fly   176 KHDVVLMKLSKPADLTRASNIRRICLPFLLAESPDQAQSETVSPPSSADEDVLIQQLELEDVPEK 240
              ||.::.||:|...||  .|:.||||                                      
  Fly   492 --DVAILTLSEPVPFTR--EIQPICLP-------------------------------------- 514

  Fly   241 IDNFLRSVQSRRRYRNVTAPSMKELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDS 305
                             |:||.:.                   ||:.                  
  Fly   515 -----------------TSPSQQS-------------------RSYS------------------ 525

  Fly   306 DDSAEQKHPKVSDEPKEIAFVDCVATGWGKANISGDLSNQLLKTQVPLHQNGRCRDAYGSFV--N 368
                           .::|.|    .|||....:|...:.|.|..:|:..|..|...||...  .
  Fly   526 ---------------GQVATV----AGWGSLRENGPQPSILQKVDIPIWTNAECARKYGRAAPGG 571

  Fly   369 IHGGHLCAGKLNGEGGTCVGDSGGPLQCRLSRDGPWILVGVTSFGSGCALEGFPDVYTRTSYYMK 433
            |....:|||:...:  :|.||||||:.  ::..|.:..||:.|:|.||....:|.||||.:..:.
  Fly   572 IIESMICAGQAAKD--SCSGDSGGPMV--INDGGRYTQVGIVSWGIGCGKGQYPGVYTRVTSLLP 632

  Fly   434 WIEDTI 439
            ||...|
  Fly   633 WIYKNI 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 83/369 (22%)
Tryp_SPc 81..438 CDD:238113 84/371 (23%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 83/369 (22%)
Tryp_SPc 400..637 CDD:238113 84/371 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.