DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG3355

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster


Alignment Length:441 Identity:104/441 - (23%)
Similarity:142/441 - (32%) Gaps:191/441 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QSQTQSRPKSRLQSRPQSRSQSLSQSQCHWQIPATSTATLSWLCLLLLLPSSRQFETDCGCRPAR 76
            ||....||       |:||:|..::..|....|..:                             
  Fly    46 QSIKAVRP-------PKSRNQCTAKQNCFCGTPNVN----------------------------- 74

  Fly    77 RGPRIIAGAATNEGQFPWQASL--ELLHPSLGFLGHWCGAVLIHQYWILSAAHCVHNDLFNLPIP 139
               ||:.|......::||.|.|  ...:|.|     :||..||:..::|:||||||.:...:   
  Fly    75 ---RIVGGQQVRSNKYPWTAQLVKGRHYPRL-----FCGGSLINDRYVLTAAHCVHGNRDQI--- 128

  Fly   140 PLWTVVLGEHDRDVESGNEQRIP--VEKIV---MHHRY--HNFKHDVVLMKLSKPADLTRASNIR 197
               |:.|.:.||      ..|.|  |.|:|   :|..|  :...:||.|:||..|..||  .|:|
  Fly   129 ---TIRLLQIDR------SSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLT--GNMR 182

  Fly   198 RICLPFLLAESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRNVTAPSM 262
            .:|||                                              ::...:...||   
  Fly   183 PVCLP----------------------------------------------EANHNFDGKTA--- 198

  Fly   263 KELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPKVSDEPKEIAFVD 327
                                                                             
  Fly   199 ----------------------------------------------------------------- 198

  Fly   328 CVATGWGKANISGDLSNQLLKTQVPLHQNGRCRDA-YGSFVNIHGGHLCAGKLNGEGG--TCVGD 389
             |..|||.....|..||.|.:..||:..|.:||.. |..  .|....|||| |..:||  .|.||
  Fly   199 -VVAGWGLIKEGGVTSNYLQEVNVPVITNAQCRQTRYKD--KIAEVMLCAG-LVQQGGKDACQGD 259

  Fly   390 SGGPLQCRLSRDGPWILVGVTSFGSGCALEGFPDVYTRTSYYMKWIEDTIA 440
            |||||   :..:|.:.|.||.|||.|||.:..|.||.|.|.::.||....|
  Fly   260 SGGPL---IVNEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRKNTA 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 91/366 (25%)
Tryp_SPc 81..438 CDD:238113 92/368 (25%)
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 91/366 (25%)
Tryp_SPc 76..305 CDD:238113 92/368 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.