DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG40160

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster


Alignment Length:398 Identity:86/398 - (21%)
Similarity:137/398 - (34%) Gaps:161/398 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 CGCRPARRGPRIIAGAATNE---GQFPWQASLELLHPSLGFLGHWCGAVLIHQYWILSAAHCVHN 131
            ||.|........::|.:.||   |:|||  ::.|||.  |.|.::|...|||:..:|:|||||.:
  Fly   151 CGVRNTGGLDFTLSGVSQNEAGFGEFPW--TVALLHS--GNLSYFCAGSLIHKQVVLTAAHCVES 211

  Fly   132 DLFNLPIPPL----WTVVLGEHDRDVESGNEQRIP-----VEKIVMHHRYH--NFKHDVVLMKLS 185
                     |    :||..||.|...   .::|:|     |:.:::|..|:  :..:|..|:.||
  Fly   212 ---------LRTGSFTVRAGEWDTQT---MKERLPYQERSVQTVILHPDYNRRSIAYDFALVILS 264

  Fly   186 KPADLTRASNIRRICLPFLLAESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQS 250
            :|..|....|:  ||||                           ||   :|:|:..:.       
  Fly   265 QPVTLDDHINV--ICLP---------------------------QQ---DDIPQPGNT------- 290

  Fly   251 RRRYRNVTAPSMKELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPK 315
                                                                             
  Fly   291 ----------------------------------------------------------------- 290

  Fly   316 VSDEPKEIAFVDCVATGWGKANIS--GDLSNQLLKTQVPLHQNGRCR-----DAYGSFVNIHGGH 373
                        |.:|||||....  |..|:.:.:..:|:.:...|:     ...|....:....
  Fly   291 ------------CFSTGWGKDAFGSLGKYSSLMKRVPLPIVEFNSCQTRLRGTRLGPKFALDRSF 343

  Fly   374 LCAGKLNGEGG--TCVGDSGGPLQC--RLSRDGPWILVGVTSFGSGCALEGFPDVYTRTSYYMKW 434
            :|||   |:.|  ||.||.|.||.|  ..:|:..:...|:.::|.||..| .|..|...:....|
  Fly   344 ICAG---GQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGIGCNDE-VPAAYANVALVRGW 404

  Fly   435 IEDTIATH 442
            |:..:.|:
  Fly   405 IDQQMLTN 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 80/379 (21%)
Tryp_SPc 81..438 CDD:238113 82/381 (22%)
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 81/377 (21%)
Tryp_SPc 169..405 CDD:214473 79/371 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.