DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG14227

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster


Alignment Length:343 Identity:69/343 - (20%)
Similarity:111/343 - (32%) Gaps:146/343 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 CGAVLIHQYWILSAAHCVHNDLFNLPIPPLWTVVLGEHD-----RDVESG----NEQRIPVEKIV 167
            |...||:..::|:|||||..:...        |.||:.|     ::..||    |...:.::|.:
  Fly    70 CSGSLINHRFVLTAAHCVFREAMQ--------VHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKI 126

  Fly   168 MHHRYHNF---KHDVVLMKLSKPADLTRASNIRRICLPFLLAESPDQAQSETVSPPSSADEDVLI 229
            :|..:...   ::|:.|:::......  :..:|.|||              .::.|.:|      
  Fly   127 VHAGFGKIQAQQYDIGLLRMQHAVQY--SDFVRPICL--------------LINEPVAA------ 169

  Fly   230 QQLELEDVPEKIDNFLRSVQSRRRYRNVTAPSMKELMNMKILSRMRQALAQRSPRSHKRSRRRND 294
                       ||.|..:|.      ..||...:.:                 ||..|.|     
  Fly   170 -----------IDRFQLTVW------GTTAEDFRSI-----------------PRVLKHS----- 195

  Fly   295 KLMKLGPRRDSDDSAEQKHPKVSDEPKEIAFVDCVATGWGKANISGDLSNQLLKTQVPLHQNGRC 359
                :|.|.|                :|:    |.                 ||.|..:.::..|
  Fly   196 ----VGDRID----------------REL----CT-----------------LKFQQQVDESQIC 219

  Fly   360 RDAYGSFVNIHGGHLCAGKLNGEGGTCVGDSGGPLQCRLSRDGPW--ILVGVTSFG-SGCALEGF 421
                   |:....|           .|.||||||...::...|.:  ...|:..|| |.||  |.
  Fly   220 -------VHTETSH-----------ACKGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCA--GL 264

  Fly   422 PDVYTRTSYYMKWIEDTI 439
             .|.|..::||.||.|.:
  Fly   265 -SVCTNVTFYMDWIWDAL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 66/337 (20%)
Tryp_SPc 81..438 CDD:238113 68/340 (20%)
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 66/337 (20%)
Tryp_SPc 57..277 CDD:238113 66/337 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.