DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG33160

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:377 Identity:77/377 - (20%)
Similarity:115/377 - (30%) Gaps:164/377 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PRIIAG--AATNEGQFPWQ--ASLELLHPSLGFLGHWCGAVLIHQYWILSAAHCVHNDLFNLPIP 139
            ||||.|  ::..|.::..|  .|.||           ||..|:...|:::|||||:|.       
  Fly    32 PRIIGGHVSSIKEEKYLVQVTTSEEL-----------CGGSLVKPRWVITAAHCVYNK------- 78

  Fly   140 PLWTVVLGEHDRDVESGNEQRIPVEKIVMHHRYHNFKHDVVLMKLSKPADLTRASNIRRICLPFL 204
                   .::|..:..|                                    |||         
  Fly    79 -------NKNDFKIYGG------------------------------------ASN--------- 91

  Fly   205 LAESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRNVTAPSMKELMNMK 269
                  ||....|                           :|:|.    |..:.....::.:||.
  Fly    92 ------QAGPYAV---------------------------IRTVD----YIAIRPDFNRKTLNMD 119

  Fly   270 ILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHP-----KVSDEPKEIAFVDCV 329
            :                 .:.|.|..:  :|...::...|.|..|     |||            
  Fly   120 V-----------------AALRLNSDM--IGANIETIPLAAQSVPARALVKVS------------ 153

  Fly   330 ATGWG----KANISGDLSNQLLKTQVPLHQNGRCRDAYGSFVNIHGGHLCAGKLNGEGGTCVGDS 390
              |||    .|..:.:..:.:|   ||:.....|..|:.....|....:||.:|. :..:|.|||
  Fly   154 --GWGFLTADATKTAERVHSVL---VPMWSRASCVSAFRGIHRITRSMVCAARLY-KKDSCDGDS 212

  Fly   391 GGPLQCRLSRDGPWILVGVTSFGSGCALEGFPDVYTRTSYYMKWIEDTIATH 442
            ||||..|..      |.|:.|||.||| ...|.:||.......|.:..:..|
  Fly   213 GGPLVYRGQ------LAGIVSFGYGCA-SALPGIYTSVPEIRDWFQRVVEQH 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 74/367 (20%)
Tryp_SPc 81..438 CDD:238113 74/369 (20%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 74/366 (20%)
Tryp_SPc 34..253 CDD:238113 74/369 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.