DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG33127

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster


Alignment Length:361 Identity:71/361 - (19%)
Similarity:110/361 - (30%) Gaps:145/361 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 PWQASLELLHPSLGFLGHWCGAVLIHQYWILSAAHCV------HNDLFNLPIPPLWTVVLGEHDR 151
            |:..||.|...:   ..|.|||.:|.:.|:|:|||||      :.|....|:   :..::     
  Fly    54 PYLVSLSLTRAT---YTHLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPV---YAGII----- 107

  Fly   152 DVESGNEQRIPVEKIVMHHRYHNFKHDVVLMKLSKPADLTRASNIRRICLPFLLAESPDQAQSET 216
                 |...:...::    ||.:|            |...|:.|              ..|.|:.
  Fly   108 -----NRSNVTAAQV----RYVDF------------ASTHRSFN--------------GNAGSDN 137

  Fly   217 VS---PPSSADEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRNVTAPSMKELMNMKILSRMRQAL 278
            ::   ...|.:.:..:||:.|.|:.:.             |.|.||                   
  Fly   138 IALLHVSESFEYNARVQQIALPDINDD-------------YSNKTA------------------- 170

  Fly   279 AQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPKVSDEPKEIAFVDCVATGWGKANISGD-L 342
                                                              .|.|||..:..|| .
  Fly   171 --------------------------------------------------AAYGWGLTDPDGDEY 185

  Fly   343 SNQLLKTQVPLHQNGRCRDAYGSFVNIHGGHLCAGKLNGEGGTCVGDSGGPLQCRLSRDGPWILV 407
            |.:|.....||..:..|::...:...:....:|:     :..||.||.|.|| ......||..||
  Fly   186 SKELQYAFAPLLNSTGCKELLPADAPLTAQQVCS-----QVKTCYGDGGTPL-IYWPITGPAELV 244

  Fly   408 GVTSFG-SGCALEGFPDVYTRTSYYMKWIEDTIATH 442
            |:.|:. ..|.....|.|||....|:.||..||..:
  Fly   245 GLGSWSYMPCGYANRPTVYTSVPPYIGWIHQTIGAY 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 67/352 (19%)
Tryp_SPc 81..438 CDD:238113 69/355 (19%)
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 69/355 (19%)
Tryp_SPc 41..273 CDD:214473 67/352 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.