DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG33226

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:418 Identity:90/418 - (21%)
Similarity:135/418 - (32%) Gaps:170/418 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LSWL--CLLLLLPSSRQFETD-----CGCRPARRGPRIIAGAATNEGQFPWQASLELLHPSLGFL 108
            :.||  |.:|.|.|......|     |...|.....:|:.|...:....||.  :::|  ..|: 
  Fly    10 MKWLLVCFILALRSYESLGQDLLDPNCVQTPVGVREQILGGHNADIKLHPWM--VQIL--QRGY- 69

  Fly   109 GHWCGAVLIHQYWILSAAHCVHNDLFNLPIPPLWTVVLGEHDRDVESGNEQR------------- 160
             |:||..||...::|:||||  :..:.|      .|..|.:     ||...|             
  Fly    70 -HFCGGSLISSLFVLTAAHC--HSRYRL------KVRFGRY-----SGITPRYLCSSQYCSPFGP 120

  Fly   161 -IPVEKIVMHHRYHNF-KHDVVLMKLSKPADLTRASNIRRICLPFLLAESPDQAQSETVSPPSSA 223
             |.|::|.:|..|.:: .:|:.|..|:||.                                   
  Fly   121 EIDVKRIFLHSSYRDYHNYDIALFLLAKPV----------------------------------- 150

  Fly   224 DEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRNVTAPSMKELMNMKILSRMRQALAQRSPRSHKR 288
                                         ||...|.|.               .:.|.|      
  Fly   151 -----------------------------RYNVQTRPI---------------CVLQTS------ 165

  Fly   289 SRRRNDKLMKLGPRRDSDDSAEQKHPKVSDEPKEIAFVDCVA----TGWGKANISGDLSNQLLKT 349
               ..|||.:                          |::.||    |||||.  ...|::.:|:|
  Fly   166 ---NKDKLRQ--------------------------FLNYVAMFNVTGWGKT--ESQLTSTILQT 199

  Fly   350 QVPLHQNGR-CRDAYGSFVNIHGGHLCAGKLNGEGGTCVGDSGGPLQCRLSRDG--PWILVGVTS 411
            ....|.:.: |...:..  .|...|:|||  :.:..||.|||||||...|:..|  ..:|.|:.|
  Fly   200 TSLFHLDRKFCAQIFDR--KIGWPHICAG--HSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIIS 260

  Fly   412 FGSGCALEGFPDVYTRTSYYMKWIEDTI 439
            :|:....|  ..|:|....|..||.|.:
  Fly   261 YGAPNCRE--VTVFTNVLRYSNWIRDIV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 78/376 (21%)
Tryp_SPc 81..438 CDD:238113 80/378 (21%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 80/378 (21%)
Tryp_SPc 47..282 CDD:214473 78/375 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.