DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and Klkb1

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_036857.2 Gene:Klkb1 / 25048 RGDID:67382 Length:638 Species:Rattus norvegicus


Alignment Length:374 Identity:91/374 - (24%)
Similarity:137/374 - (36%) Gaps:131/374 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 TDCGCRPARRGPRIIAGAATNEGQFPWQASLELLHPSLGFLGHWCGAVLIHQYWILSAAHCVHND 132
            :||   ..:...||:.|..::.|::|||.||::   .|....|.||..:|.:.|||:||||..  
  Rat   381 SDC---TTKINARIVGGTNSSLGEWPWQVSLQV---KLVSQNHMCGGSIIGRQWILTAAHCFD-- 437

  Fly   133 LFNLPIPPLWTVVLGEHDRDVESGNEQRIPVEKIVMHHRY--HNFKHDVVLMKLSKPADLTRASN 195
              .:|.|.:|.:..|..:....:.......::::::|.:|  ....:|:.|:||..|.:.|... 
  Rat   438 --GIPYPDVWRIYGGILNLSEITNKTPFSSIKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQ- 499

  Fly   196 IRRICLPFLLAESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRNVTAP 260
             :.|||                  ||.||.:.:                                
  Rat   500 -KPICL------------------PSKADTNTI-------------------------------- 513

  Fly   261 SMKELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPKVSDEPKEIAF 325
                                                                            :
  Rat   514 ----------------------------------------------------------------Y 514

  Fly   326 VDCVATGWGKANISGDLSNQLLKTQVPLHQNGRCRDAYGSFVNIHGGHLCAGKLNGEGGTCVGDS 390
            .:|..||||.....|:..|.|.|..:||..|..|:..|..:| |....:|||...|....|.|||
  Rat   515 TNCWVTGWGYTKERGETQNILQKATIPLVPNEECQKKYRDYV-ITKQMICAGYKEGGIDACKGDS 578

  Fly   391 GGPLQCRLSRDGPWILVGVTSFGSGCALEGFPDVYTRTSYYMKWIEDTI 439
            ||||.|:.|  |.|.|||:||:|.|||.:..|.|||:.:.|:.||.:.|
  Rat   579 GGPLVCKHS--GRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKI 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 86/356 (24%)
Tryp_SPc 81..438 CDD:238113 87/358 (24%)
Klkb1NP_036857.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519
Tryp_SPc 390..621 CDD:214473 86/356 (24%)
Tryp_SPc 391..621 CDD:238113 85/355 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.