DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG30289

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:406 Identity:84/406 - (20%)
Similarity:128/406 - (31%) Gaps:170/406 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LCLLLLLPS--SRQFETDCG-CRPARRGPRIIAGAATNEGQFPWQASLELLHPSLGFLGHWCGAV 115
            :||.:...:  ||....:|| .:.....|.|..||.||..:.||...:....|        ||..
  Fly    12 VCLFIANNNVMSRLLVENCGISKDDPYVPNIFGGAKTNIQENPWMVLVWSSKP--------CGGS 68

  Fly   116 LIHQYWILSAAHCV-HNDLFNLPIPPLWTVVLGEH---DRDVESGNEQRIP------VEKIVMHH 170
            ||.:.::|:||||| ..||:         |.||::   |......|...||      |:..::|.
  Fly    69 LIARQFVLTAAHCVSFEDLY---------VRLGDYETLDPMPYCLNNHCIPKFYNISVDMKIVHE 124

  Fly   171 RYH--NFKHDVVLMKLSKPADLTRASNIRRICLPFLLAESPDQAQSETVSPPSSADEDVLIQQLE 233
            .|:  ..::|:.|:::|:..:.  :..:|.|||  |:.|                         :
  Fly   125 NYNGITLQNDIALLRMSEAVEY--SDYVRPICL--LVGE-------------------------Q 160

  Fly   234 LEDVPEKIDNFLRSVQSRRRYRNVTAPSMKELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMK 298
            ::.:|.                                                           
  Fly   161 MQSIPM----------------------------------------------------------- 166

  Fly   299 LGPRRDSDDSAEQKHPKVSDEPKEIAFVDCVATGWGKANISGDLSNQLLKTQVPLHQNGRCRDAY 363
                                         ...||||:... |..|..||        |....:..
  Fly   167 -----------------------------FTVTGWGETEY-GQFSRILL--------NATLYNMD 193

  Fly   364 GSFVNI------HGGHLCAGKLNGEGGTCVGDSGGPLQCRLSRDGPWIL---VGVTSFGSGCALE 419
            .|:.||      ....:|||  :....||.|||||||..:. ..|..:|   .|:.|:||.....
  Fly   194 ISYCNIKFNKQADRSQICAG--SHTSNTCKGDSGGPLSSKF-HYGNRLLSFQYGLVSYGSERCAA 255

  Fly   420 GFPDVYTRTSYYMKWI 435
            ....|||..||:.:||
  Fly   256 NVAGVYTNVSYHREWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 75/375 (20%)
Tryp_SPc 81..438 CDD:238113 77/376 (20%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 75/374 (20%)
Tryp_SPc 42..271 CDD:238113 75/374 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.