DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG30288

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:413 Identity:80/413 - (19%)
Similarity:124/413 - (30%) Gaps:173/413 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CL---LLLLPSSRQFETDCGCRPAR-RGPRIIAGAATNEGQFPWQASLELLHPSLGFLGHWCGAV 115
            ||   ::...|.|..|.|||...:. ...||..|........||...:.:...::      ||..
  Fly    13 CLFIGIIRTESGRLLENDCGTTSSNGYRARIDGGRDAGMESNPWMVRVMISGKAV------CGGS 71

  Fly   116 LIHQYWILSAAHCVHNDLFNLPIPPLWTVVLGEHDRD---------VESGNEQRIPVEKIVMHHR 171
            ||...::|:|.||:.        |....|.|||:|..         |.:.....:.|::.::|  
  Fly    72 LITARFVLTAEHCIS--------PMYMNVRLGEYDTRHPIFDCDDFVCTPRAYNVDVDRKIVH-- 126

  Fly   172 YHNFKHDVVLMKLSKPADLTRASNIRRICLPFLLAESPDQAQSETVSPPSSADEDVLIQQLELED 236
             .|..:|:.|:::.:  .:..::.:|.|||  :|.::                         |..
  Fly   127 -SNPGYDIGLLRMQR--SVIFSNYVRPICL--ILGKT-------------------------LGG 161

  Fly   237 VPEKIDNFLRSVQSRRRYRNVTAPSMKELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGP 301
            .|..|..|                      |.                                 
  Fly   162 NPLSILRF----------------------NF--------------------------------- 171

  Fly   302 RRDSDDSAEQKHPKVSDEPKEIAFVDCVATGWGKANISGDLSNQLLKT---QVP---LHQNGRCR 360
                                         |||| .|..|:..::|...   |:|   ..:.||..
  Fly   172 -----------------------------TGWG-TNSDGEEQDRLQTATLQQLPQWSCERPGRPL 206

  Fly   361 DAYGSFVNIHGGHLCAGKLNGEGGTCVGDSGGPLQC--RLSRDGPWILVGVTSFG----SGCALE 419
            |.         .::|||....:  :|.|||||||..  .....|.....||.|.|    ||..  
  Fly   207 DI---------SYICAGSYISD--SCKGDSGGPLSAIRTFEGQGRVFQFGVASQGLRLCSGLG-- 258

  Fly   420 GFPDVYTRTSYYMKWIEDTIATH 442
                :||..:::..||.|.|..|
  Fly   259 ----IYTNVTHFTDWILDVIQNH 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 67/375 (18%)
Tryp_SPc 81..438 CDD:238113 68/377 (18%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 67/375 (18%)
Tryp_SPc 45..270 CDD:238113 65/372 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.