DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG30083

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:397 Identity:87/397 - (21%)
Similarity:138/397 - (34%) Gaps:167/397 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LLLLLPS--SRQFETDCGCRPARRGPRIIAGAATNEGQFPWQASL---------ELLHPSLGFLG 109
            ::||.|.  |:..|.:||....  .|:|:.|.....|..||.|.:         ||:        
  Fly     9 IILLWPGAMSQFLEPNCGYPDI--SPKIMHGQNAENGTNPWMAYIFKYNDKEVAELV-------- 63

  Fly   110 HWCGAVLIHQYWILSAAHCVHNDLFNLPIPPLWTVVLGEHDRDVESGNEQRIPVEKIVMHHRYH- 173
              ||..|||:.::||||||:..|       .:..|.||||      .:.:...|.| ...::|. 
  Fly    64 --CGGTLIHKQFVLSAAHCIKRD-------QILAVRLGEH------SSSRYFAVTK-AFRNKYFT 112

  Fly   174 --NFKHDVVLMKLSKPADLTRASNIRRICLPFLLAESPDQAQSETVSPPSSADEDVLIQQLELED 236
              ::.:|:.::::.........  ||.||:                                   
  Fly   113 TGSYSNDIGILRIQPIVKFNAV--IRPICI----------------------------------- 140

  Fly   237 VPEKIDNFLRSVQSRRRYRNVTAPSMKELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGP 301
                                :|.|:  ::.|:|...                             
  Fly   141 --------------------ITDPT--KVPNVKTFK----------------------------- 154

  Fly   302 RRDSDDSAEQKHPKVSDEPKEIAFVDCVATGWGKANISGDLSNQLLKTQVPLHQNGRCRDAYGS- 365
                                        |.||||.  ..:..:::||| |.|::. ...:.|.. 
  Fly   155 ----------------------------AAGWGKT--ENETFSKVLKT-VELNEL-NASECYNML 187

  Fly   366 FVNIHGGHLCAGKLNGEGGTCVGDSGGPLQCRLSRDGP--WILVGVTSFGSGCALEGFPDVYTRT 428
            :||:....:|||  :.:|.||.|||||||...:..||.  ::.:|:.||||  :|...|.||||.
  Fly   188 WVNVTESQICAG--HPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGS--SLCNSPGVYTRL 248

  Fly   429 SYYMKWI 435
            |.::.||
  Fly   249 SSFIDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 77/369 (21%)
Tryp_SPc 81..438 CDD:238113 79/370 (21%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 77/369 (21%)
Tryp_SPc 34..255 CDD:238113 77/368 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.